Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5225
Gene name
LocationContig_4:38456..55986
Strand+
Gene length (bp)17530
Transcript length (bp)17403
Coding sequence length (bp)17403
Protein length (aa) 5801

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 8.0E-70 641 1040
PF00501 AMP-binding AMP-binding enzyme 4.4E-73 1731 2132
PF00501 AMP-binding AMP-binding enzyme 2.5E-73 2817 3209
PF00501 AMP-binding AMP-binding enzyme 2.0E-66 3894 4297
PF00501 AMP-binding AMP-binding enzyme 4.5E-80 4988 5386
PF00668 Condensation Condensation domain 7.0E-37 201 600
PF00668 Condensation Condensation domain 7.2E-43 1291 1687
PF00668 Condensation Condensation domain 6.7E-29 2462 2768
PF00668 Condensation Condensation domain 2.5E-44 3457 3847
PF00668 Condensation Condensation domain 5.9E-36 4546 4939
PF00550 PP-binding Phosphopantetheine attachment site 8.8E-11 94 156
PF00550 PP-binding Phosphopantetheine attachment site 1.9E-08 1187 1247
PF00550 PP-binding Phosphopantetheine attachment site 5.0E-10 2270 2331
PF00550 PP-binding Phosphopantetheine attachment site 2.5E-09 3350 3412
PF00550 PP-binding Phosphopantetheine attachment site 2.9E-10 4440 4499
PF00550 PP-binding Phosphopantetheine attachment site 2.4E-08 5523 5585
PF07993 NAD_binding_4 Male sterility protein 1.3E-29 5638 5758

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2699 5597 0.0E+00
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 550 3427 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1744 4840 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 623 3766 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2793 5576 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2699 5597 0.0E+00
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 550 3427 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1744 4840 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 623 3766 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2793 5576 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1290 3592 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2376 4677 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3454 5763 0.0E+00
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1740 4844 0.0E+00
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2836 5563 0.0E+00
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 687 3758 0.0E+00
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2794 5575 0.0E+00
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3441 5439 0.0E+00
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2775 5562 0.0E+00
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1692 4513 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1290 3422 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3457 5631 0.0E+00
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2775 5562 0.0E+00
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1692 4513 0.0E+00
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1657 4491 0.0E+00
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2791 5573 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2355 5563 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1274 4672 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 198 3597 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 23 2500 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3457 5564 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2810 4513 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 637 2437 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1720 3527 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3889 5564 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 32 5575 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 194 5589 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 28 4500 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1288 4843 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2374 5564 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 198 3757 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 18 2689 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3455 5569 0.0E+00
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1290 5562 0.0E+00
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 197 4500 0.0E+00
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 5 3422 0.0E+00
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2376 5564 0.0E+00
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1290 5562 0.0E+00
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 197 4500 0.0E+00
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 5 3422 0.0E+00
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2376 5564 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2808 4938 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1722 3847 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 3877 5581 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 637 2672 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 12 1588 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2808 4892 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 3877 5581 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1722 3847 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 637 2672 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 26 1588 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2808 4939 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1722 3847 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 3877 5581 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 637 2697 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 26 1684 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2534 4688 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3619 5564 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1658 3417 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 569 2357 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 17 1464 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 633 4836 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1720 5558 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 32 3731 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2787 5573 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2740 4499 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1656 3623 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3807 5563 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 566 2497 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2 1459 0.0E+00
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1290 4676 0.0E+00
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 196 3589 0.0E+00
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2369 5556 0.0E+00
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2376 5564 0.0E+00
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 200 3428 0.0E+00
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1290 4499 0.0E+00
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 194 3725 0.0E+00
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2370 5569 0.0E+00
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1284 4854 0.0E+00
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 293 3730 0.0E+00
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2464 5564 0.0E+00
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1361 4750 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1273 3655 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3451 5593 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2376 4847 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2320 4675 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1290 3847 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 194 2323 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3454 5581 0.0E+00
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 532 3501 2.0E-180
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 622 3591 3.0E-180
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 194 2334 5.0E-180
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 532 3501 7.0E-180
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2373 4941 5.0E-179
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3456 5592 3.0E-178
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 198 2321 1.0E-177
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 9 1247 2.0E-177
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1275 3228 7.0E-177
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2376 4938 1.0E-176
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2861 4860 3.0E-176
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2376 4846 3.0E-176
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1272 3790 4.0E-175
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 177 2184 1.0E-174
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1669 4684 3.0E-174
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 199 2549 5.0E-174
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2376 4677 7.0E-174
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1437 3718 7.0E-173
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2374 4308 1.0E-171
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 194 2330 6.0E-170
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 199 2536 1.0E-169
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 192 2692 2.0E-169
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 3453 5599 9.0E-169
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 25 2537 7.0E-168
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3459 5586 8.0E-168
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3457 5573 1.0E-167
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 3773 5600 3.0E-167
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1290 3411 3.0E-167
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3457 5627 4.0E-167
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1290 3410 4.0E-167
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 603 3622 6.0E-167
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2376 4487 2.0E-166
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3455 4935 3.0E-166
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1290 3592 1.0E-165
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2513 4824 6.0E-165
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1703 2823 9.0E-165
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 194 2345 1.0E-164
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2348 3829 2.0E-164
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 638 2692 2.0E-164
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3455 5575 2.0E-164
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 28 2354 2.0E-164
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2376 4861 3.0E-164
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3455 5575 3.0E-164
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1284 3846 5.0E-164
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 151 2311 4.0E-163
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 32 2354 6.0E-163
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 23 2338 2.0E-162
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1736 3862 1.0E-161
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 550 2656 2.0E-161
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 200 2330 3.0E-161
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2787 3909 6.0E-161
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3457 5589 1.0E-160
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2376 4711 2.0E-160
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 3451 5583 2.0E-160
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1289 2672 7.0E-159
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 199 2338 2.0E-158
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2376 4508 2.0E-158
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3869 4979 4.0E-158
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 194 2347 4.0E-158
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 15 1605 6.0E-158
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2376 3852 2.0E-156
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1291 3678 1.0E-155
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 32 2690 2.0E-153
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3453 5586 5.0E-153
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 26 2444 4.0E-152
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3453 4864 2.0E-151
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 3891 5596 2.0E-151
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 590 1718 2.0E-151
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1719 3411 2.0E-151
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2345 4744 1.0E-150
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 181 2543 3.0E-150
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 198 1590 1.0E-149
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3455 5558 2.0E-149
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 17 2331 1.0E-148
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 200 1588 2.0E-147
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 3449 5631 7.0E-147
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 28 2339 8.0E-147
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 632 2354 2.0E-144
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 14 2660 2.0E-142
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1290 2676 2.0E-142
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 28 2435 1.0E-139
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 28 2435 6.0E-139
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 35 2348 2.0E-136
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 3879 5592 2.0E-136
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 3859 5595 3.0E-135
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 3490 5732 5.0E-135
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2807 4500 2.0E-134
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 18 1249 4.0E-134
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2584 4678 9.0E-132
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1367 3590 3.0E-131
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2483 4809 1.0E-130
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 3885 4865 2.0E-130
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4543 5564 3.0E-129
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 3546 5562 3.0E-128
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 3858 5572 3.0E-127
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3793 5575 6.0E-127
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3793 5575 2.0E-126
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2812 4509 6.0E-123
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2794 3778 7.0E-123
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 4544 5553 4.0E-122
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2759 4492 9.0E-122
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 299 2651 2.0E-121
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 3529 5572 6.0E-120
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3671 4529 1.0E-118
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2579 3606 1.0E-118
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 21 1605 6.0E-118
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 4545 5563 2.0E-116
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1377 3425 2.0E-116
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4529 5564 8.0E-116
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 632 1588 2.0E-115
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1506 2508 3.0E-115
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 623 2321 6.0E-115
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1721 2693 7.0E-115
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1730 3749 1.0E-114
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 4544 5593 5.0E-113
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 3811 4842 7.0E-112
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 32 1572 2.0E-111
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 3908 5575 2.0E-110
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2776 3845 2.0E-109
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4722 5604 3.0E-109
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1674 2674 3.0E-109
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 569 1590 3.0E-108
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 655 2667 9.0E-107
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 411 1246 2.0E-105
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 4534 5558 4.0E-104
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2802 4498 1.0E-102
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2259 3774 4.0E-101
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 4935 5558 2.0E-100
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 4519 5601 3.0E-98
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2744 3411 8.0E-98
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1715 3783 1.0E-97
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 648 2696 1.0E-96
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 32 1641 2.0E-96
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 4544 5626 6.0E-96
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 4545 5578 7.0E-96
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1196 2448 3.0E-95
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 4569 5589 3.0E-95
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 4545 5574 5.0E-95
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2376 3444 6.0E-95
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2376 3590 7.0E-95
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1383 2347 2.0E-94
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2400 3418 2.0E-94
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1290 2321 3.0E-94
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 4964 5602 1.0E-93
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 4545 5574 2.0E-93
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2376 3386 5.0E-93
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2376 3431 2.0E-92
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 4725 5553 7.0E-92
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1272 2321 2.0E-91
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4970 5614 2.0E-91
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 28 1245 2.0E-91
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3352 4836 3.0E-91
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3423 4506 3.0E-91
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 3856 4536 4.0E-91
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 4545 5569 5.0E-91
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 28 1253 9.0E-91
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 28 1248 1.0E-90
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 199 1248 2.0E-90
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 21 1455 3.0E-90
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1663 2341 3.0E-90
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 28 1250 1.0E-89
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1176 2692 1.0E-89
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1265 2326 2.0E-89
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3336 4861 2.0E-89
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1287 2339 5.0E-89
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 4918 5577 8.0E-89
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 4899 5575 2.0E-88
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3457 4500 5.0E-88
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1272 2259 7.0E-88
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1285 2338 2.0E-87
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1656 2500 3.0E-87
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3563 4492 4.0E-87
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 52 1699 5.0E-87
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2945 4500 7.0E-87
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 28 1246 8.0E-87
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 32 1249 9.0E-87
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 36 1258 1.0E-86
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 571 1236 1.0E-86
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3481 4492 1.0E-86
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 199 1343 2.0E-86
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4545 5493 4.0E-86
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 4544 5573 4.0E-86
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1290 2354 9.0E-86
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 4545 5575 2.0E-85
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 32 1258 1.0E-84
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3884 5573 2.0E-84
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2359 3411 3.0E-84
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3867 4672 3.0E-84
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 32 1470 1.0E-83
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2790 3585 7.0E-83
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 151 1246 8.0E-83
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 32 1246 1.0E-82
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 224 1246 6.0E-82
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 4545 5556 2.0E-81
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 32 1576 5.0E-81
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3 586 8.0E-81
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3453 4492 1.0E-80
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2372 3412 7.0E-80
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 4545 5588 1.0E-79
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 4427 5573 4.0E-79
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 3455 4500 1.0E-78
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 561 1418 1.0E-78
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 775 2334 1.0E-77
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 12 1349 4.0E-77
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2370 3313 9.0E-77
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 24 1246 1.0E-76
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 22 1245 1.0E-76
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2 1611 2.0E-76
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 199 1238 4.0E-76
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 4642 5590 9.0E-76
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 198 1163 1.0E-75
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 196 1247 3.0E-75
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 16 1247 3.0E-75
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2464 3411 5.0E-75
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 15 1233 5.0E-75
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3298 4880 2.0E-74
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 4981 5576 3.0E-74
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1127 2703 4.0E-74
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 31 1246 5.0E-74
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2709 3731 2.0E-73
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 3888 4676 5.0E-73
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2806 3589 7.0E-73
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2459 3411 8.0E-73
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3467 4492 1.0E-72
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3424 4414 1.0E-72
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1295 2330 3.0E-72
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 35 1220 5.0E-72
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2211 3756 6.0E-72
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 205 1223 7.0E-72
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 4871 5749 2.0E-71
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 4648 5615 3.0E-71
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 36 1268 2.0E-70
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 199 1246 2.0E-70
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 4981 5749 2.0E-70
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2808 3410 3.0E-70
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2808 3410 4.0E-70
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 4620 5567 3.0E-69
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 4981 5617 3.0E-69
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2778 3864 5.0E-69
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 4634 5564 7.0E-68
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 4978 5562 5.0E-67
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 4978 5562 7.0E-67
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 635 1246 8.0E-67
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 4924 5562 1.0E-66
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 4635 5575 1.0E-65
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 32 1244 5.0E-65
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1380 2142 5.0E-65
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2827 3418 2.0E-64
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3810 4847 2.0E-64
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1720 2306 3.0E-64
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1720 2306 3.0E-64
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2378 3223 3.0E-64
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 622 1683 8.0E-64
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 100 1644 1.0E-63
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 3888 4679 1.0E-63
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 635 1285 2.0E-63
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 635 1285 2.0E-63
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1724 2344 4.0E-63
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 3888 4679 4.0E-63
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 22 1237 2.0E-62
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 4650 5431 3.0E-62
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 4981 5597 6.0E-62
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1724 2546 1.0E-61
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1654 2322 4.0E-61
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1706 2334 4.0E-60
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 4970 5558 3.0E-59
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 553 1238 2.0E-58
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3805 4686 4.0E-58
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4445 5564 4.0E-57
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3480 4352 7.0E-57
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 4981 5766 2.0E-56
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 3886 4500 4.0E-56
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 4981 5766 4.0E-56
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 620 1253 1.0E-55
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 4925 5623 2.0E-55
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 4656 5758 4.0E-54
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 4999 5685 2.0E-51
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 19 1100 2.0E-51
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 4942 5756 5.0E-51
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 202 1084 7.0E-51
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1748 2641 8.0E-51
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 4981 5761 1.0E-49
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2861 3793 8.0E-49
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 3471 4500 2.0E-48
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1677 2236 1.0E-47
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1380 2306 4.0E-47
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 4981 5556 4.0E-47
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3125 3834 4.0E-47
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 4932 5490 7.0E-47
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 4653 5756 1.0E-46
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1725 2330 1.0E-46
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1725 2330 1.0E-46
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 3859 4407 2.0E-46
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2803 3427 2.0E-46
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2803 3427 2.0E-46
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 4980 5494 3.0E-46
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 4980 5494 3.0E-46
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 4980 5494 6.0E-46
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1380 2306 7.0E-46
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 4980 5494 1.0E-45
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 3471 4500 2.0E-45
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 4980 5494 3.0E-45
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 4981 5596 6.0E-45
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 4980 5494 6.0E-45
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 4981 5596 6.0E-45
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 4981 5596 7.0E-45
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 4980 5494 8.0E-45
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 4980 5494 8.0E-45
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 4980 5494 8.0E-45
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 4980 5494 8.0E-45
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 4980 5494 9.0E-45
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 4980 5494 9.0E-45
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 4980 5494 9.0E-45
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 4980 5494 9.0E-45
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 4980 5494 1.0E-44
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1380 2306 1.0E-44
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 5006 5595 3.0E-44
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1624 2331 3.0E-44
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2041 2688 8.0E-44
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 4980 5494 9.0E-44
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3913 4842 1.0E-43
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 3863 4501 1.0E-43
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 3863 4501 1.0E-43
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2808 3436 1.0E-43
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2808 3436 2.0E-43
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2808 3436 2.0E-43
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 953 1604 3.0E-43
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1618 2311 8.0E-43
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 4202 4852 3.0E-42
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1648 2331 4.0E-42
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2763 3317 5.0E-42
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 565 1265 6.0E-42
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 565 1265 6.0E-42
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 4599 5571 8.0E-42
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 4955 5571 8.0E-42
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2808 3411 8.0E-42
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 606 1149 1.0E-41
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 4955 5564 1.0E-41
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2626 3387 4.0E-41
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 4981 5568 7.0E-41
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 284 1256 1.0E-40
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1719 2316 3.0E-40
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 228 1256 4.0E-40
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1671 2399 6.0E-40
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1671 2352 7.0E-40
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1671 2352 7.0E-40
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 3856 4500 1.0E-39
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 5006 5494 1.0E-39
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2626 3387 2.0E-39
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 633 1222 2.0E-39
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 633 1222 2.0E-39
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 633 1222 2.0E-39
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2711 3415 3.0E-39
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2814 3387 4.0E-39
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 4985 5494 4.0E-39
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1636 2334 5.0E-39
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 4962 5574 1.0E-38
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 4962 5574 1.0E-38
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1 496 3.0E-38
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1729 2236 4.0E-38
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1729 2236 4.0E-38
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1729 2236 4.0E-38
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 4981 5494 4.0E-38
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 659 1247 6.0E-38
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1729 2236 7.0E-38
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1729 2236 7.0E-38
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 660 1565 9.0E-38
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2813 3317 1.0E-37
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2813 3317 1.0E-37
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2813 3317 2.0E-37
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2813 3317 2.0E-37
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2813 3317 2.0E-37
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2813 3317 2.0E-37
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2813 3317 2.0E-37
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1729 2236 4.0E-37
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1729 2236 4.0E-37
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1729 2236 4.0E-37
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1729 2236 4.0E-37
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1729 2236 4.0E-37
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2717 3432 5.0E-37
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1728 2236 5.0E-37
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2813 3317 5.0E-37
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2876 3319 5.0E-37
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2697 3412 6.0E-37
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2813 3317 6.0E-37
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2813 3317 6.0E-37
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2813 3317 6.0E-37
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2813 3317 6.0E-37
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1729 2236 8.0E-37
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 451 1256 8.0E-37
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 661 1246 9.0E-37
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2691 3427 1.0E-36
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2813 3317 1.0E-36
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2813 3317 1.0E-36
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1729 2236 1.0E-36
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1729 2236 1.0E-36
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2813 3317 1.0E-36
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 4980 5495 3.0E-36
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 3880 4491 5.0E-36
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 3880 4491 5.0E-36
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 3880 4491 5.0E-36
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2813 3317 5.0E-36
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 544 1272 6.0E-36
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 565 1247 7.0E-36
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2721 3412 9.0E-36
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 4981 5572 1.0E-35
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 3889 4412 1.0E-35
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2836 3411 1.0E-35
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1729 2236 1.0E-35
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2827 3313 2.0E-35
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2808 3447 2.0E-35
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2876 3319 3.0E-35
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 4985 5494 4.0E-35
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 636 1256 7.0E-35
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 5017 5399 1.0E-34
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2810 3412 2.0E-34
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2876 3319 2.0E-34
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 4976 5494 2.0E-34
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1729 2241 2.0E-34
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 3912 4515 2.0E-34
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1654 2330 2.0E-34
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2395 3418 2.0E-34
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 21 511 2.0E-34
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 4985 5494 3.0E-34
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1729 2236 3.0E-34
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2827 3313 7.0E-34
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1783 2241 1.0E-33
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 636 1226 1.0E-33
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1729 2240 2.0E-33
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1729 2240 2.0E-33
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 4983 5494 2.0E-33
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1729 2241 2.0E-33
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 4983 5494 2.0E-33
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 4983 5494 2.0E-33
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 4983 5494 2.0E-33
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 4980 5494 3.0E-33
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 4989 5494 3.0E-33
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1729 2241 3.0E-33
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 5004 5494 3.0E-33
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 5048 5427 3.0E-33
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 563 1241 3.0E-33
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1748 2241 3.0E-33
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 4989 5494 4.0E-33
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1729 2241 4.0E-33
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 4983 5494 4.0E-33
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 4983 5494 4.0E-33
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 4983 5494 4.0E-33
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 561 1246 5.0E-33
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 5006 5494 6.0E-33
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1729 2241 6.0E-33
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 636 1247 7.0E-33
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 3487 4510 7.0E-33
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2813 3318 1.0E-32
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 4989 5494 1.0E-32
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2827 3313 1.0E-32
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2826 3313 2.0E-32
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2836 3319 2.0E-32
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2878 3219 2.0E-32
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 4983 5494 2.0E-32
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 4983 5494 2.0E-32
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 4989 5494 3.0E-32
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 3758 4513 3.0E-32
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 4989 5495 3.0E-32
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1646 2194 3.0E-32
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2824 3313 3.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2869 3313 3.0E-32
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2869 3313 3.0E-32
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2869 3313 3.0E-32
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2869 3313 3.0E-32
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2869 3313 3.0E-32
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2869 3313 3.0E-32
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2869 3313 3.0E-32
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1383 2331 4.0E-32
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1727 2240 5.0E-32
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2869 3313 5.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2869 3313 5.0E-32
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2869 3313 5.0E-32
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2869 3313 5.0E-32
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2869 3313 5.0E-32
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2869 3313 5.0E-32
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2869 3313 5.0E-32
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 3889 4500 5.0E-32
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2829 3313 6.0E-32
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1725 2238 9.0E-32
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 3889 4407 1.0E-31
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 3889 4407 1.0E-31
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 3889 4407 1.0E-31
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 3889 4407 1.0E-31
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 3889 4407 1.0E-31
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2869 3313 1.0E-31
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1729 2242 1.0E-31
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1724 2331 2.0E-31
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2836 3319 2.0E-31
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 3889 4407 2.0E-31
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 5006 5494 2.0E-31
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 5006 5494 2.0E-31
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2836 3319 3.0E-31
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 3889 4407 3.0E-31
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 5006 5494 3.0E-31
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 5006 5494 3.0E-31
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 5006 5494 3.0E-31
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 5006 5494 3.0E-31
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 5006 5494 4.0E-31
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2836 3319 4.0E-31
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 3889 4407 4.0E-31
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 3889 4407 4.0E-31
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 3889 4407 4.0E-31
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 3889 4407 4.0E-31
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 4989 5496 4.0E-31
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 4989 5494 5.0E-31
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 638 1157 5.0E-31
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 28 593 5.0E-31
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 3889 4405 7.0E-31
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 3815 4500 7.0E-31
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 654 1157 8.0E-31
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 654 1157 8.0E-31
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 4989 5496 8.0E-31
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 4989 5496 8.0E-31
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 4989 5496 8.0E-31
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 4989 5496 8.0E-31
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 4989 5496 8.0E-31
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 4989 5496 8.0E-31
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 4989 5496 8.0E-31
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1671 2309 8.0E-31
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 629 1247 9.0E-31
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 3889 4407 9.0E-31
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 5006 5494 1.0E-30
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 5006 5494 1.0E-30
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1729 2242 1.0E-30
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2836 3318 1.0E-30
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1656 2325 1.0E-30
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 3912 4495 1.0E-30
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 4981 5494 1.0E-30
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 654 1157 1.0E-30
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 654 1157 1.0E-30
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 654 1157 1.0E-30
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 654 1157 1.0E-30
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 654 1157 1.0E-30
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 654 1157 1.0E-30
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 654 1157 1.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 5006 5494 2.0E-30
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1729 2242 2.0E-30
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1747 2241 2.0E-30
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 3913 4492 2.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2836 3319 2.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 4989 5494 2.0E-30
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 4989 5496 2.0E-30
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 4989 5496 2.0E-30
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 4989 5496 2.0E-30
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 4989 5496 2.0E-30
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 4989 5496 2.0E-30
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 4989 5496 2.0E-30
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1727 2241 3.0E-30
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2808 3319 3.0E-30
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1727 2241 3.0E-30
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 3887 4497 3.0E-30
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 4978 5436 3.0E-30
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 654 1157 3.0E-30
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 654 1157 3.0E-30
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 654 1157 3.0E-30
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 3889 4407 4.0E-30
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 3889 4407 4.0E-30
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3321 3847 5.0E-30
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 3889 4407 6.0E-30
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 3889 4407 6.0E-30
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 4989 5496 6.0E-30
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 654 1157 6.0E-30
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 4989 5494 8.0E-30
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 640 1157 9.0E-30
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 6 514 9.0E-30
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 3797 4506 1.0E-29
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2836 3406 1.0E-29
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 654 1157 1.0E-29
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2836 3319 2.0E-29
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 642 1158 2.0E-29
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 4983 5496 2.0E-29
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2821 3317 2.0E-29
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2821 3317 2.0E-29
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2821 3317 2.0E-29
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2821 3317 2.0E-29
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2810 3317 2.0E-29
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2821 3317 2.0E-29
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1725 2241 2.0E-29
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2821 3317 3.0E-29
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2821 3317 3.0E-29
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2821 3317 3.0E-29
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1725 2241 3.0E-29
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2836 3319 3.0E-29
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2836 3319 3.0E-29
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 28 473 4.0E-29
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1747 2241 5.0E-29
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1725 2241 5.0E-29
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1725 2241 5.0E-29
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1725 2241 5.0E-29
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1725 2241 5.0E-29
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1725 2241 5.0E-29
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1725 2241 5.0E-29
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1725 2241 5.0E-29
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 3885 4408 6.0E-29
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1747 2241 8.0E-29
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1747 2241 8.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2821 3317 9.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2821 3317 9.0E-29
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1725 2241 9.0E-29
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1725 2241 9.0E-29
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1725 2241 9.0E-29
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1725 2241 9.0E-29
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1725 2241 9.0E-29
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1725 2241 9.0E-29
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 3907 4407 1.0E-28
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 3885 4408 1.0E-28
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1749 2342 1.0E-28
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 3897 4409 1.0E-28
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 638 1151 2.0E-28
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 4983 5496 2.0E-28
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 3885 4408 2.0E-28
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1792 2142 2.0E-28
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 640 1159 2.0E-28
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2836 3313 2.0E-28
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 3885 4408 3.0E-28
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 3893 4405 4.0E-28
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 3935 4500 5.0E-28
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 3873 4511 6.0E-28
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 640 1151 8.0E-28
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1737 2238 8.0E-28
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 3885 4413 1.0E-27
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 3907 4407 2.0E-27
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 634 1264 2.0E-27
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 3882 4322 3.0E-27
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2811 3227 3.0E-27
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 579 1050 5.0E-27
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2872 3317 6.0E-27
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 3892 4415 7.0E-27
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 3907 4407 7.0E-27
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 638 1154 8.0E-27
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 5 494 8.0E-27
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 3954 4409 2.0E-26
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 23 494 2.0E-26
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 3885 4408 3.0E-26
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 645 1153 4.0E-26
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 4980 5496 5.0E-26
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1729 2238 1.0E-25
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 638 1150 1.0E-25
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 3897 4405 1.0E-25
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 3897 4405 1.0E-25
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 3897 4405 1.0E-25
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 3897 4405 1.0E-25
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 3897 4405 1.0E-25
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 3897 4405 1.0E-25
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1750 2241 2.0E-25
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1750 2241 2.0E-25
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 645 1153 2.0E-25
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1750 2241 2.0E-25
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1750 2241 2.0E-25
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1750 2241 2.0E-25
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 645 1153 3.0E-25
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 3900 4412 5.0E-25
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2836 3317 5.0E-25
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 3900 4412 5.0E-25
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 3897 4405 5.0E-25
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 3897 4405 5.0E-25
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 3897 4405 5.0E-25
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 3897 4405 5.0E-25
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 3897 4405 5.0E-25
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 3897 4405 5.0E-25
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 3897 4405 5.0E-25
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 3897 4405 8.0E-25
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1750 2241 1.0E-24
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1750 2241 1.0E-24
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 3897 4405 1.0E-24
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2873 3317 2.0E-24
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 634 1158 2.0E-24
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2873 3317 2.0E-24
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2873 3317 2.0E-24
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2873 3317 2.0E-24
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 640 1156 3.0E-24
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 640 1156 3.0E-24
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 634 1158 5.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3348 3822 7.0E-24
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 4981 5564 7.0E-24
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 640 1156 7.0E-24
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 640 1156 7.0E-24
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 640 1156 7.0E-24
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 640 1156 7.0E-24
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 640 1156 7.0E-24
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 640 1156 7.0E-24
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 640 1156 7.0E-24
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2258 2687 8.0E-24
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4437 5404 9.0E-24
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 640 1156 1.0E-23
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 640 1156 1.0E-23
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 640 1156 1.0E-23
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 640 1156 1.0E-23
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 640 1156 1.0E-23
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 640 1156 1.0E-23
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2873 3317 2.0E-23
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2873 3317 2.0E-23
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 4993 5496 2.0E-23
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1173 1590 2.0E-23
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 644 1155 3.0E-23
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 3891 4407 4.0E-23
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2939 3387 4.0E-23
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 3955 4407 5.0E-23
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 3955 4407 6.0E-23
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 3955 4407 6.0E-23
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 3955 4407 6.0E-23
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 3955 4407 6.0E-23
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 3955 4407 6.0E-23
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 3955 4407 6.0E-23
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 644 1154 7.0E-23
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 3955 4407 7.0E-23
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 3955 4407 7.0E-23
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 3955 4407 7.0E-23
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 3955 4407 7.0E-23
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2836 3313 9.0E-23
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2189 2661 9.0E-23
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1790 2242 9.0E-23
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1790 2242 9.0E-23
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1790 2242 9.0E-23
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1790 2242 1.0E-22
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1790 2242 1.0E-22
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1790 2242 1.0E-22
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 3955 4407 2.0E-22
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1747 2242 2.0E-22
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3268 3845 2.0E-22
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 644 1155 2.0E-22
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1790 2242 2.0E-22
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1790 2242 2.0E-22
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1790 2242 2.0E-22
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1790 2242 2.0E-22
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1790 2242 2.0E-22
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 644 1155 3.0E-22
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 3955 4407 3.0E-22
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 3955 4407 3.0E-22
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 644 1155 5.0E-22
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1 496 6.0E-22
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 24 590 8.0E-22
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 644 1155 1.0E-21
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3424 3891 1.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3461 4290 2.0E-21
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3343 3756 3.0E-21
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 637 1158 1.0E-20
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2290 2703 1.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 100 1033 1.0E-20
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 642 1150 2.0E-20
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 637 1158 2.0E-20
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 637 1158 2.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 9 593 3.0E-20
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 3891 4407 4.0E-20
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 31 612 4.0E-20
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4653 4864 5.0E-20
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 75 496 6.0E-20
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 3891 4407 1.0E-19
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 3954 4407 1.0E-19
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 3891 4407 1.0E-19
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 3891 4407 1.0E-19
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 3891 4407 1.0E-19
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 624 1159 2.0E-19
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 32 526 2.0E-19
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 199 529 2.0E-19
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 3891 4407 3.0E-19
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 3891 4407 3.0E-19
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2929 3403 3.0E-19
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 4427 4846 4.0E-19
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2811 3385 1.0E-18
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2813 3312 1.0E-18
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3960 4308 2.0E-18
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 3898 4405 2.0E-18
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1787 2337 3.0E-18
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 5000 5502 3.0E-18
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 4990 5494 4.0E-18
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 5046 5564 1.0E-17
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1177 1590 1.0E-17
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 644 1153 2.0E-17
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 5006 5494 2.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 289 509 2.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4545 4987 2.0E-17
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 3889 4510 3.0E-17
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 5004 5491 3.0E-17
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 660 1050 6.0E-17
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 14 370 7.0E-17
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 4434 4866 1.0E-16
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 24 496 1.0E-16
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2261 2701 1.0E-16
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1290 1588 1.0E-16
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 5043 5613 2.0E-16
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 5302 5563 2.0E-16
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 4981 5491 3.0E-16
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1747 2142 3.0E-16
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2338 2672 3.0E-16
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 87 517 4.0E-16
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 4987 5494 4.0E-16
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3272 3586 4.0E-16
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 5004 5491 5.0E-16
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1790 2306 6.0E-16
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 704 1050 7.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4 260 8.0E-16
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 15 514 9.0E-16
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 5044 5558 1.0E-15
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 638 1160 1.0E-15
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 638 1160 1.0E-15
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 638 1160 1.0E-15
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 638 1160 1.0E-15
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 638 1160 2.0E-15
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 638 1160 2.0E-15
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 638 1160 2.0E-15
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 28 404 2.0E-15
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 638 1158 3.0E-15
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 661 1160 4.0E-15
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 638 1160 4.0E-15
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 638 1160 4.0E-15
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 638 1160 4.0E-15
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 638 1158 6.0E-15
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 4038 4480 6.0E-15
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 638 1158 6.0E-15
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 638 1158 6.0E-15
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 638 1158 6.0E-15
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1183 1609 7.0E-15
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 4994 5490 7.0E-15
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 4985 5485 8.0E-15
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 4979 5396 8.0E-15
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 5006 5494 8.0E-15
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 642 1158 8.0E-15
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 19 337 8.0E-15
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 3935 4308 9.0E-15
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 5006 5494 1.0E-14
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2815 3219 1.0E-14
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 3955 4477 2.0E-14
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 5108 5494 3.0E-14
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2834 3219 3.0E-14
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 5529 5759 3.0E-14
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2377 2785 4.0E-14
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2949 3312 4.0E-14
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2945 3312 4.0E-14
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 3271 3534 4.0E-14
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 5 177 4.0E-14
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 638 1158 5.0E-14
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 638 1158 5.0E-14
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 661 1052 5.0E-14
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 5133 5492 5.0E-14
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 2945 3312 5.0E-14
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 5529 5759 6.0E-14
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 4362 4672 6.0E-14
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 640 1153 7.0E-14
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 5004 5502 7.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1167 1588 8.0E-14
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2945 3312 8.0E-14
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 24 145 9.0E-14
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 4418 4851 1.0E-13
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 659 1154 1.0E-13
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 28 367 1.0E-13
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1869 2306 2.0E-13
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 3939 4512 2.0E-13
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 634 1153 2.0E-13
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 4987 5533 2.0E-13
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 5006 5502 2.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 32 362 3.0E-13
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 640 1154 3.0E-13
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 2815 3317 3.0E-13
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 2819 3331 4.0E-13
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 672 1077 4.0E-13
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 4988 5494 5.0E-13
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 5006 5494 5.0E-13
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 660 1050 5.0E-13
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 4972 5491 5.0E-13
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 640 1156 6.0E-13
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 658 1155 6.0E-13
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 5519 5768 6.0E-13
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2800 3219 6.0E-13
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1116 1489 6.0E-13
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 2945 3318 7.0E-13
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2801 3219 8.0E-13
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 640 1154 8.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 32 464 9.0E-13
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 4994 5490 9.0E-13
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 639 1154 9.0E-13
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 639 1154 9.0E-13
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 702 1288 1.0E-12
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 32 340 1.0E-12
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 32 340 1.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2815 3312 1.0E-12
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3457 3724 1.0E-12
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 24 333 1.0E-12
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1773 2250 1.0E-12
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 2836 3219 1.0E-12
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 5137 5426 1.0E-12
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 5133 5492 1.0E-12
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 3886 4307 2.0E-12
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 4988 5494 2.0E-12
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 636 1050 2.0E-12
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 4977 5485 2.0E-12
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2804 3335 2.0E-12
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 5132 5492 2.0E-12
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 23 334 3.0E-12
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2380 3202 3.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 3893 4407 3.0E-12
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1749 2142 3.0E-12
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 2949 3312 3.0E-12
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 4981 5493 3.0E-12
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 5133 5763 3.0E-12
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 4988 5494 4.0E-12
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 4984 5493 4.0E-12
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 4984 5493 4.0E-12
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 5004 5396 4.0E-12
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 4981 5491 6.0E-12
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 5133 5491 6.0E-12
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 782 1154 7.0E-12
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 640 1154 7.0E-12
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 5006 5491 7.0E-12
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 5006 5485 7.0E-12
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 5006 5491 7.0E-12
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 28 422 8.0E-12
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2949 3219 9.0E-12
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2949 3320 9.0E-12
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 2949 3320 9.0E-12
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 640 1154 9.0E-12
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2949 3320 9.0E-12
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2949 3320 9.0E-12
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 2949 3320 9.0E-12
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2949 3320 9.0E-12
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2949 3320 9.0E-12
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2949 3320 9.0E-12
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 5519 5757 9.0E-12
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 2936 3318 1.0E-11
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 4994 5494 1.0E-11
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 4994 5494 1.0E-11
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 4981 5495 1.0E-11
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 4969 5492 1.0E-11
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 4985 5533 1.0E-11
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 5004 5426 1.0E-11
sp|Q6FXI2|ACS2_CANGA Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 1726 2258 1.0E-11
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 670 1050 1.0E-11
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 661 1050 1.0E-11
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 24 594 1.0E-11
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2949 3320 1.0E-11
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2949 3320 1.0E-11
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 4985 5533 2.0E-11
sp|Q9F7R5|ACSA_PRB01 Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 4993 5491 2.0E-11
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 635 1159 2.0E-11
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 2949 3320 2.0E-11
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 2949 3320 2.0E-11
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 4985 5533 2.0E-11
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 2836 3219 2.0E-11
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 2836 3219 2.0E-11
sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 4994 5491 2.0E-11
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 32 400 2.0E-11
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2836 3219 2.0E-11
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 3910 4308 2.0E-11
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 5025 5491 2.0E-11
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 2814 3219 2.0E-11
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2196 2435 2.0E-11
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 4987 5533 3.0E-11
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 5521 5756 3.0E-11
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 4983 5496 3.0E-11
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 5000 5494 3.0E-11
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 1738 2237 3.0E-11
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 2949 3320 3.0E-11
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 2949 3320 3.0E-11
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 775 1065 3.0E-11
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 4985 5532 3.0E-11
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 4985 5532 3.0E-11
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 5006 5495 3.0E-11
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1728 2247 4.0E-11
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1728 2247 4.0E-11
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1725 2305 4.0E-11
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 5006 5492 4.0E-11
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 4985 5532 4.0E-11
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 4987 5434 4.0E-11
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 28 363 4.0E-11
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1748 2111 4.0E-11
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 4974 5494 4.0E-11
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2922 3219 4.0E-11
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 766 1050 4.0E-11
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 2835 3219 4.0E-11
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 26 383 4.0E-11
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 1745 2089 5.0E-11
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 4987 5533 5.0E-11
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 660 1050 5.0E-11
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2951 3219 5.0E-11
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 3895 4322 6.0E-11
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 5006 5494 6.0E-11
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2373 2641 7.0E-11
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 4976 5494 7.0E-11
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 4983 5397 8.0E-11
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 4983 5397 8.0E-11
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 4994 5491 8.0E-11
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 2836 3318 9.0E-11
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 2949 3320 9.0E-11
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 2949 3320 9.0E-11
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3348 3718 1.0E-10
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 1690 2182 1.0E-10
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 4983 5491 1.0E-10
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2949 3320 1.0E-10
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2949 3320 1.0E-10
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2949 3320 1.0E-10
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2949 3320 1.0E-10
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 759 1050 1.0E-10
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2949 3320 1.0E-10
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2949 3320 1.0E-10
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2949 3320 1.0E-10
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 14 158 1.0E-10
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2949 3320 1.0E-10
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2949 3320 1.0E-10
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 5006 5494 1.0E-10
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 652 1065 1.0E-10
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 1744 2142 1.0E-10
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4431 4861 2.0E-10
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 660 1077 2.0E-10
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 5094 5411 2.0E-10
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 3897 4307 2.0E-10
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 2837 3219 2.0E-10
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 638 1154 2.0E-10
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 4994 5491 2.0E-10
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1748 2142 2.0E-10
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2949 3320 2.0E-10
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 4983 5496 2.0E-10
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 4983 5496 2.0E-10
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2949 3320 2.0E-10
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 1744 2078 2.0E-10
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 2942 3219 2.0E-10
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 659 1051 2.0E-10
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2951 3219 2.0E-10
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 702 1223 3.0E-10
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 2795 3219 3.0E-10
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 655 1050 3.0E-10
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 2954 3312 3.0E-10
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 2949 3320 3.0E-10
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 4994 5491 3.0E-10
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 13 329 3.0E-10
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 5132 5397 3.0E-10
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 1868 2240 4.0E-10
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 2836 3318 4.0E-10
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 5006 5485 4.0E-10
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 5006 5485 4.0E-10
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 5006 5485 4.0E-10
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 2950 3225 4.0E-10
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 2954 3312 4.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 658 1095 4.0E-10
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 4994 5435 4.0E-10
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 1744 2078 4.0E-10
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 4987 5532 4.0E-10
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 5004 5426 4.0E-10
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 1868 2240 4.0E-10
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 1868 2240 4.0E-10
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 5132 5397 5.0E-10
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1835 2111 5.0E-10
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 2954 3312 5.0E-10
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 661 1050 5.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 77 149 5.0E-10
sp|Q96VC7|ACS2_ZYGBA Acetyl-coenzyme A synthetase 2 OS=Zygosaccharomyces bailii GN=ACS2 PE=3 SV=1 1726 2258 5.0E-10
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 661 1124 5.0E-10
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 3914 4348 5.0E-10
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 1868 2240 5.0E-10
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 1868 2240 5.0E-10
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 1868 2240 5.0E-10
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 1868 2240 5.0E-10
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 1868 2240 5.0E-10
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 1868 2240 5.0E-10
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 1868 2240 5.0E-10
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 1868 2240 5.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 94 533 6.0E-10
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 1868 2240 6.0E-10
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 1868 2240 6.0E-10
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2836 3219 6.0E-10
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 2949 3312 6.0E-10
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 4987 5434 6.0E-10
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 5514 5758 6.0E-10
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 5529 5756 6.0E-10
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 5133 5397 7.0E-10
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 5133 5397 7.0E-10
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 660 1157 7.0E-10
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 780 1159 7.0E-10
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 643 1155 8.0E-10
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 4994 5491 8.0E-10
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 2808 3318 1.0E-09
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 95 494 1.0E-09
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 1868 2240 1.0E-09
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2951 3219 1.0E-09
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 5133 5397 1.0E-09
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 5133 5397 1.0E-09
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1261 1558 1.0E-09
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4648 4815 1.0E-09
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 5005 5500 1.0E-09
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 5137 5494 1.0E-09
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 4987 5434 1.0E-09
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 1868 2241 1.0E-09
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 2935 3228 1.0E-09
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 3886 4409 2.0E-09
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1209 1609 2.0E-09
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3350 3765 2.0E-09
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1868 2234 2.0E-09
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 1744 2147 2.0E-09
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 32 602 2.0E-09
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 5006 5496 2.0E-09
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 3895 4334 2.0E-09
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 661 1154 2.0E-09
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 3895 4334 2.0E-09
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 5006 5485 2.0E-09
sp|A7MB45|ACSS3_BOVIN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus GN=ACSS3 PE=2 SV=1 2944 3319 2.0E-09
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 3895 4334 2.0E-09
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 641 1154 2.0E-09
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 3895 4334 2.0E-09
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 661 1154 2.0E-09
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 4414 4840 3.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2924 3219 3.0E-09
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 1736 2243 3.0E-09
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 3910 4308 3.0E-09
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2874 3229 3.0E-09
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 5004 5485 3.0E-09
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 3895 4334 3.0E-09
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 3895 4334 3.0E-09
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 661 1154 3.0E-09
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 5132 5432 3.0E-09
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 4987 5397 3.0E-09
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 5626 5763 3.0E-09
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 3910 4410 3.0E-09
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2815 3219 4.0E-09
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 5133 5388 4.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 5025 5396 4.0E-09
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 5133 5388 4.0E-09
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 5133 5388 4.0E-09
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 5133 5388 4.0E-09
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2815 3219 4.0E-09
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 5133 5388 4.0E-09
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 784 1150 4.0E-09
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 1736 2142 4.0E-09
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 5006 5494 4.0E-09
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 4979 5422 4.0E-09
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 3895 4334 5.0E-09
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 5006 5494 5.0E-09
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 661 1154 5.0E-09
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 661 1154 5.0E-09
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 661 1154 5.0E-09
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 661 1154 5.0E-09
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 661 1154 5.0E-09
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 657 1050 5.0E-09
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 2949 3219 5.0E-09
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 2923 3312 5.0E-09
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 5133 5388 5.0E-09
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 5133 5388 5.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 685 1050 5.0E-09
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 2931 3312 5.0E-09
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 4981 5491 6.0E-09
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 3895 4334 6.0E-09
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 661 1154 6.0E-09
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 648 1077 6.0E-09
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 1736 2243 6.0E-09
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 1736 2243 6.0E-09
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 4011 4344 6.0E-09
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 4981 5491 7.0E-09
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 2817 3318 7.0E-09
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 3895 4334 7.0E-09
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 3895 4334 7.0E-09
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 3895 4334 7.0E-09
sp|Q5REB8|ACSS3_PONAB Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii GN=ACSS3 PE=2 SV=1 2944 3319 7.0E-09
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1769 2246 7.0E-09
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 5006 5485 7.0E-09
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 5133 5396 7.0E-09
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 5133 5388 7.0E-09
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1736 2238 7.0E-09
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 2813 3246 7.0E-09
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 3895 4334 8.0E-09
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 3895 4334 8.0E-09
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 661 1154 8.0E-09
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 2951 3219 8.0E-09
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 1736 2243 8.0E-09
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 1711 2142 8.0E-09
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 637 1155 9.0E-09
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 780 1147 9.0E-09
sp|Q9H6R3|ACSS3_HUMAN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens GN=ACSS3 PE=1 SV=1 2944 3319 9.0E-09
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 5241 5438 9.0E-09
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 1725 2111 9.0E-09
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 1725 2111 9.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 5006 5396 9.0E-09
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2811 3219 9.0E-09
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 1736 2243 1.0E-08
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 661 1154 1.0E-08
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 661 1154 1.0E-08
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 2795 3211 1.0E-08
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2813 3323 1.0E-08
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 5125 5494 1.0E-08
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 661 1154 1.0E-08
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 1721 2256 1.0E-08
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 661 1154 1.0E-08
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1738 2237 1.0E-08
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 2950 3318 1.0E-08
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 677 1050 1.0E-08
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 4033 4308 1.0E-08
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 4971 5485 1.0E-08
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 5006 5396 1.0E-08
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 1736 2105 1.0E-08
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 673 1090 1.0E-08
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 1736 2243 2.0E-08
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 780 1154 2.0E-08
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 780 1154 2.0E-08
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 3908 4308 2.0E-08
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 774 1056 2.0E-08
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 661 1154 2.0E-08
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 661 1154 2.0E-08
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 774 1051 2.0E-08
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 5002 5491 2.0E-08
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 661 1154 2.0E-08
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 661 1154 2.0E-08
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 661 1154 2.0E-08
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 661 1154 2.0E-08
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 638 1054 2.0E-08
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2815 3219 2.0E-08
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 1736 2230 2.0E-08
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 3913 4310 2.0E-08
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1744 2142 2.0E-08
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 5006 5485 2.0E-08
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 32 164 2.0E-08
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 659 1050 2.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 2912 3325 2.0E-08
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 5454 5581 2.0E-08
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 4981 5491 3.0E-08
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 652 1154 3.0E-08
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 1736 2243 3.0E-08
sp|P55912|PRPE_SALTY Propionate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpE PE=3 SV=2 5135 5491 3.0E-08
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 5004 5426 3.0E-08
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 1736 2243 3.0E-08
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 1736 2243 3.0E-08
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 5132 5508 3.0E-08
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2815 3219 3.0E-08
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2815 3219 3.0E-08
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 652 1054 3.0E-08
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 4981 5491 3.0E-08
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 2949 3318 3.0E-08
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 5114 5493 4.0E-08
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 630 1166 4.0E-08
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2813 3323 4.0E-08
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2813 3323 4.0E-08
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 1736 2243 4.0E-08
sp|Q8NJN3|ACS2_CANAL Acetyl-coenzyme A synthetase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACS2 PE=3 SV=2 4983 5491 4.0E-08
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2907 3329 4.0E-08
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 4983 5496 4.0E-08
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2818 3219 4.0E-08
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 1868 2240 4.0E-08
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 784 1164 5.0E-08
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 1736 2243 5.0E-08
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 2900 3219 6.0E-08
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 661 1154 6.0E-08
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2935 3219 6.0E-08
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 1736 2238 6.0E-08
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 22 163 7.0E-08
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 1866 2258 7.0E-08
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 661 1154 7.0E-08
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1107 1545 7.0E-08
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 5298 5493 8.0E-08
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 661 1095 8.0E-08
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 661 1154 8.0E-08
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 661 1154 8.0E-08
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 2955 3219 8.0E-08
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 655 1050 9.0E-08
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 5133 5763 9.0E-08
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 2952 3312 9.0E-08
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 659 1051 9.0E-08
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 1736 2142 9.0E-08
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 27 155 1.0E-07
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2293 2694 1.0E-07
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 5095 5396 1.0E-07
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5 146 1.0E-07
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 778 1087 1.0E-07
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 1868 2247 1.0E-07
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2949 3219 1.0E-07
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5 146 1.0E-07
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 1868 2247 1.0E-07
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 1868 2240 1.0E-07
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 1736 2243 1.0E-07
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2815 3219 2.0E-07
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 780 1154 2.0E-07
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 774 1051 2.0E-07
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 780 1154 2.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2815 3219 2.0E-07
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 780 1154 2.0E-07
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 1868 2142 2.0E-07
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 1868 2142 2.0E-07
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 2957 3219 2.0E-07
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 4981 5491 2.0E-07
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2949 3322 2.0E-07
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 5006 5396 2.0E-07
sp|B2HHZ8|FAC17_MYCMM Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 5036 5490 2.0E-07
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 778 1087 2.0E-07
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 2951 3312 2.0E-07
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 778 1054 2.0E-07
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 1736 2142 2.0E-07
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 1728 2230 2.0E-07
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 1721 2256 2.0E-07
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 1868 2247 2.0E-07
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 5135 5492 2.0E-07
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 4989 5493 2.0E-07
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 774 1051 2.0E-07
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 774 1051 2.0E-07
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 2807 3227 2.0E-07
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 774 1051 3.0E-07
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 780 1154 3.0E-07
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 780 1154 3.0E-07
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2815 3219 3.0E-07
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 774 1051 3.0E-07
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2815 3219 3.0E-07
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2815 3219 3.0E-07
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 3874 4411 3.0E-07
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 3874 4411 3.0E-07
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 4032 4313 3.0E-07
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 774 1051 3.0E-07
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 780 1154 3.0E-07
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 774 1051 3.0E-07
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 780 1154 3.0E-07
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 774 1051 3.0E-07
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 774 1051 3.0E-07
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 780 1154 3.0E-07
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 780 1154 3.0E-07
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 774 1051 3.0E-07
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 774 1051 3.0E-07
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 774 1051 3.0E-07
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2951 3224 4.0E-07
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2815 3219 4.0E-07
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 1868 2247 4.0E-07
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 14 163 4.0E-07
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 1868 2247 4.0E-07
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 637 1155 4.0E-07
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 2832 3313 4.0E-07
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 1868 2247 4.0E-07
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 2811 3312 4.0E-07
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 2811 3312 4.0E-07
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 1868 2247 4.0E-07
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 4033 4411 4.0E-07
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 780 1154 4.0E-07
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 1728 2238 5.0E-07
sp|P28812|Y3568_PSEAE Uncharacterized protein PA3568 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3568 PE=3 SV=2 5130 5491 5.0E-07
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 1868 2240 5.0E-07
sp|Q14DH7|ACSS3_MOUSE Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus GN=Acss3 PE=1 SV=2 2943 3319 5.0E-07
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 5022 5498 5.0E-07
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 1868 2240 5.0E-07
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 1868 2247 5.0E-07
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 1739 2241 5.0E-07
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 1868 2247 5.0E-07
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 780 1154 5.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 13 157 6.0E-07
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 772 1095 6.0E-07
sp|A1ZAI3|FACR2_DROME Putative fatty acyl-CoA reductase CG8303 OS=Drosophila melanogaster GN=CG8303 PE=2 SV=2 5618 5756 6.0E-07
sp|Q960W6|FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster GN=CG8306 PE=2 SV=1 5629 5755 6.0E-07
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 1868 2247 6.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 1744 2111 6.0E-07
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 5022 5498 7.0E-07
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 5000 5426 7.0E-07
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 1868 2128 8.0E-07
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 13 162 8.0E-07
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 13 162 8.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2605 2766 8.0E-07
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 659 1051 9.0E-07
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 5025 5496 9.0E-07
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 774 1051 9.0E-07
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 635 1087 1.0E-06
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 3888 4307 1.0E-06
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 635 1087 1.0E-06
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 3888 4307 1.0E-06
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 3874 4411 1.0E-06
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1744 2089 1.0E-06
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 774 1051 1.0E-06
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 4981 5491 1.0E-06
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 774 1051 1.0E-06
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 4981 5491 1.0E-06
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 4981 5491 1.0E-06
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 18 186 1.0E-06
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 7 150 1.0E-06
sp|B2IB12|ACSA_BEII9 Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 5006 5431 1.0E-06
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 780 1153 1.0E-06
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 1868 2142 1.0E-06
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 3911 4310 1.0E-06
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 22 206 1.0E-06
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 3935 4308 1.0E-06
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 22 206 1.0E-06
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 661 1154 1.0E-06
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 22 206 1.0E-06
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 632 1050 1.0E-06
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 16 155 1.0E-06
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1717 2148 2.0E-06
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 1870 2128 2.0E-06
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 2922 3312 2.0E-06
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 4035 4409 2.0E-06
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 774 1050 2.0E-06
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 780 1147 2.0E-06
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 780 1147 2.0E-06
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 780 1147 2.0E-06
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 780 1147 2.0E-06
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 5059 5502 2.0E-06
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 3913 4308 2.0E-06
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 651 1154 2.0E-06
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 651 1154 2.0E-06
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 651 1154 2.0E-06
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 1744 2089 2.0E-06
sp|P55912|PRPE_SALTY Propionate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpE PE=3 SV=2 2955 3329 3.0E-06
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 1744 2249 3.0E-06
sp|Q8NJN3|ACS2_CANAL Acetyl-coenzyme A synthetase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACS2 PE=3 SV=2 1726 2256 3.0E-06
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 32 155 3.0E-06
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 1868 2265 3.0E-06
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 1768 2111 3.0E-06
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 4981 5494 3.0E-06
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 2836 3320 3.0E-06
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 4981 5485 3.0E-06
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 780 1087 3.0E-06
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 780 1087 3.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2953 3318 3.0E-06
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 1765 2147 3.0E-06
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1744 2142 3.0E-06
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 427 595 3.0E-06
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 5300 5494 4.0E-06
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 1749 1894 4.0E-06
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 1749 1894 4.0E-06
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 19 155 4.0E-06
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 5107 5437 4.0E-06
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 1733 2272 4.0E-06
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 660 1001 4.0E-06
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 5133 5494 4.0E-06
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 637 1155 5.0E-06
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 32 162 6.0E-06
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 21 234 6.0E-06
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2951 3219 6.0E-06
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 1744 2089 6.0E-06
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 2951 3317 6.0E-06
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 2951 3317 6.0E-06
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 2954 3312 6.0E-06
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 32 155 6.0E-06
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1744 2089 6.0E-06
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 18 176 7.0E-06
sp|P28812|Y3568_PSEAE Uncharacterized protein PA3568 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3568 PE=3 SV=2 776 1156 7.0E-06
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 2876 3219 7.0E-06
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 2952 3312 7.0E-06
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 4999 5149 7.0E-06
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 3913 4341 7.0E-06
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 35 155 7.0E-06
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 2949 3321 8.0E-06
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 2951 3317 8.0E-06
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 2954 3312 8.0E-06
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1443 1682 8.0E-06
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 632 801 9.0E-06
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 632 801 9.0E-06
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 2951 3317 9.0E-06
sp|Q7TNT2|FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus GN=Far2 PE=2 SV=1 5630 5784 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5225
MARGSDNDPVRALDAETIKKLQNVDQDLRLALPDFMVPSYYLPIHKFPLTTSGKADTRKLQEWILHLAKQQQLAP
YSLATRAEFQRPTTAMQLRLQKLWADILGLEADSIGRDDSFLRLGGDSIAAIRLVSAAREEGIHITVASIFRDPR
LSQVAASAILQDVEGQESSVAPWSLVPEAQQETMAATIRNQCRLGASDEIQDAYPATALQQGLMSLAVKQPGSYI
ARMTFQLPSDIDEHRFREAWQETLRLCPILRTRIVAQANQAIQAVISQPAEWDAGELTNVTMEHGTRLCRYALVD
GGEGKLFMLALHHAIFDGWSLPLIMRTLLGAYQHETAPALVSYARFVRYALDIDSVRAAAYWKAQLENAARPSFP
RRPDATAGPRRASSQSLARHLPFDTTDELPVTKATVLRAAWAILMAKYNDDASDITFGATVAGRQAAVTGIEEIA
GPVIATVPIRIKLDARQPVAEFLHGVQTQGAEMMPFEQFGMQNISRLGPDAKNACDFSSLLVIQPFKILKDTTNP
LLQFYTVDKDDDDAASSALTGYFTYPLVWQCCVTDTETALYVTFDSSVLSREQIETMIEQFCHIVQQLIAPDAYS
LQEVTVADICVSGTHDIALARDWNSKVCTEIISSTFHDLVQEQARIRPNAPAIFAWDGELSYRQLDVYSNRLAKM
LVKRHSICLGDLVLVCFEKSVFFYIVVLAINKAGGAWVPLDPSHPQTRHQKVTMQSEARIALVSPKQADKCRGLV
AEVITVPTELDPMSLDEDDGPPAVQVGPQDAAYVLFTSGTTGTPKGIVMEHGSLCTSQVASSRQLGLEAEQVRIL
QFAAYVFDLCIGEIIGPLISGGCLCVPSEYQRMNDIVGFINKARVNWAYLTPSFARFLVPDSVPSLQLLLLAGEP
VGKDLLSTWLGHGVRLVNGWGPSETCCFSSLLEWSSPEQSPLNIGRPVGGHCWIVDPSDHHQLAPIGCIGEVVIQ
GPTIAREYLAFEEGTRASFVTDLPAWAPRVDEHYARFYKSGDLAYYNADSTMEFVARKDTQVKVRGFRVELGEVE
HHVRLGLPEARQVVVDVLAASESDATAKLVAYLCFSSATSSPDDEGENNKNMMMALDEALSKKLLELKAYLEVRL
PQYMVPAVFIPIRHVPFITSHKINRNLLRTVTRELCAQELAPYMLSNTEKEAPATEHEVAMQKLWAEVLHVPVEL
IGRHDSFLQLGGDSLSAMRLVSKAYEAGIQLSVGSIFKDARLAQVAAAACFDDSRRHVVPEPWELIEDSKRDRME
QVVRQQCGLSDSDIISDVYPATALQEGLIALASKQPGSYMAGFTFELTTGTSVQRFKDAWEKTLARCPALRTRIV
LCSDETIQAVLERPASWGKEGETMMIMGYGTPLCAYSLTKKGDESLFSLTMHHAIFDGWSLGVIMRILSQEYDGQ
TASLSPLTPYVSFVKYTLALDEEKAAEYWRGQLAQSLRPEFPPRDTRPAASTSAQAHDSHVVRHHFAFDMKSQRL
VTKATVLRAAWAVVMARYNNADNITFGAAVAGRQASVAGIQDIVGPVLSTVPVCVGVSAGQTVKDFLLAVQAQAV
GMIAFEHMGLQNIGRLGPEARDACDFSSMFSVLYSSIVSDVQTSILKASPSSNASTDFGTYFTYPLVAQCFLSEQ
EAILELVYNSSSLSRAQVEAIAAQYSHVVEQLLSMQSADDETVLADVTLCGEWDMSRIKQWHDALPPIRPVEACI
HHLISATAAETPEKQALYASKESFTYAEFDDLTSKLAWHLGRLGVGRGSLVPFSFEKSPWAIIAMLGILKAGGAF
VPLNPNDPIARQKTLLADLGAELLLASSLTAERYGETGISVVVVTSSLLSSLSSQASSRHDERSIVGPHDIAYVL
FTSGSTGTPKGVVVEHWSLSSIVSRRPDLVTFGADSRVLQFSKFVFDVSLEEIFATLLFGGTLCIPSEEQRIDDL
ANFINEANVSCAMLTPSVARLMTPAQVPQLKTLLVAGEPPSMDLVETWSRSVELCNDYGPAEACVYVASHLMRPT
AQSASTIGRGCNSRLWIVDAENHDRLAPVGCIGELMIESPGVARHYLNDATKTEQAFFQGTSWLPRDGQRHRIYK
TGDLVRYNLDGTTEGDGTIEYIGRKDGQTKIRGQRLEIGEIEYHINHQLGPQSTSSVQLVQVEGNAALFAFVSTQ
GKTGTDETEAIAPLDKSTLHLLRNLHQGLQSILPSYMLPSYYLPIAYLPLSASGKTNGRALRQWVKHLSAEQLAD
YSLMQQVEFESPVTDMEIALQRLWGSVLKYPAEKIGLNDSFLELGGDSIRAIRLIAAAREEGIMLTVSAIFRDAR
LRMVAAAATTGQRDTVDEGNAEPLSLLPPHDLVDITNTVRQQCSLSANDVIQDIYPATPLQEGLMALATKKPGSY
TARFVYQLAPHVDVDRFTIAWQHVVRLCSTLRTRIVMCGERTVQAVVQEPAHASNLDKVEYGSPLCHCSIESRGD
ETLFKLVMHHAIFDAWSLGLILQLLIKAYHDPQSVLPPPPYANFVRYTLSLDLPQASEYWRKKLEGALRPVFPRR
SGPLVQASGGDAPSCSSKVLLHRVPFEIDGQLPVTKATVLQAAWAIVLAQYNDDAEDIVFGAVVAGRQAPVAGIE
TMIGPVLSTVPIRVSLPRRQPVQDVLLSIHAQANEMVPFEHLGIQNISKLSKDAQDACDFSSLFTIQYGAADSQS
ETPFLIPVFDADRSTDFNTYFTYPLVGQCCLLDREAQLQLVYDSSVLSEPQVARLAAQYERTVQQLLSIQHEGPG
QCLTLDKVNICTDWDKQAIEQWNSSDPELMAVNECVHELIAKRAAQMGDEEAIFSSDGCCTYKELDKMTTLVGNY
LQSQGVGIESLVPICFEKSMWTIVAMIAVMKAGGGFVPLNPDHPIQRRQQLVTALKAPLMLVSPSTFDICQEMDV
PLVTISADFVASLPESVHSHDAVPSNIAYVLFTSGSTGAPKGVVIEHRAIASSIFGHGVAMGIESGTRVLQFSNY
IFDGSITECLATLVLGGTVCVPSDGERLDGLQNFLVNARVDWAMLTPSFVRTLNREQALKTLKTLVLGGEAVPQD
VVDAWAGRVNLINAYGPAEASVCIATHTVQNSTQQQSPRTIGRGRNSRLWIVDAQNHDRLAAVYCIGELVVQGPS
LARGYLNDEKRTQQAFIQATSWLPFGEHQRLYKTGDLARYNSDGTIEYMGRKDSQVKLRGQRLEPGEVEFHIKQI
LGSQFGCSVQIARDALFAFICTAGPVQQTGKATSPGSEGNCILGVDKEVRQLFNKLQESLRLALPAFMVPSYYLS
VSQLPLTASGKIDGNALQAWALGLSTEDLVQSSPSVQVEFEPPETEMEGELQKLWSQVLGVSPDKIGRSNSFLQL
GGDSITAIRLVAAAREKHISLSVSSIFQDARLKQVAALAEFQDLSKNDEATLEPFALVLLDKCEELCQAVREQCA
LAADETVQDVFPTIPLQEGLMALAVKQPGSYMARFVFELADQVDVGRFKAAWEATLTRCAALRTRIIIHNGQTLQ
AIIQQAPDWKDANSAQLRMAYGTPLCRYYLASRGSKKQFVLTMHHAIFDGWSFGIIMRTLLQAYQGIIFSTPLTP
YAGFVKYVVELDVERAAEFWNEQLDGALQPVFPRRAAASSRLVDAATASRTLVHQVPFEAPPAMSVTKATVLRAA
WAITLARYNDGTDDITFGAAVAGRQAPVSGIEGMVGPVISTLPVRVKLNSQQRVGEFLGDLQSQATDMMPFEHMG
LQNIAKLGSSAREACDFSSLLVIQPQAITGDVESGFLKLRRTDADDDQYFSYPLVWQCYLAGDQVHLHVTYDSSV
LGEKQASLMANQFCHVVEQLLAPDVHLETSSVVVGDVTLCGPRDLAIVTEWNKKRQAEIVSSTLHELVAKQARMR
PSCPAIYAWDGQLSYQELDTISTRWATYLSYKYHVKSEELVPLCFEKSLWFYVAMLAVNKAGGAWLPLDPSHPTH
RHQVVVKQAKARIILTSPTAVEKARGLARHVEVLSPEADKAVTETLRDNGIALSVKAVQPSNIAYVLFTSGTTGT
PKGMVMEHGALCSSMTASSKRLGIDPDNVRQLQFAAYVFDLAIGEIIPALISGACICVPSEHQRLNDLSSFVAES
RANWAYLTPSFSRILSPTDVPGLEVLMFAGEAVGTDHLAKWFGRLRLINAWGPSEACCFASFREYETVDDSPLNI
GFPVGARSWIVEPDDYHRLVPIGCVGEIMLQGPTLAREYLAFEAGTKASFITDLPEWAPDREQVPYSRFYKSGDL
GYYNADGTMEFVARKDTQVKIRGFRIELGEVESQVRNAVGGIQQVTVDVLKSQGVDRLVAYLCYSSAMRTPESGN
SDFSDLLLPMDETMTQEAASLKSFLQVRLPLYMVPTVYIPVRYMPFITSQKTDRRILRQTASSISNAELEQYMLA
NATKEPPATAMETLLQSLWADVLSIPTERIGRNDSFLHLGGDSLGAIRLITKARQHGVQLSVANIFKDARLSQVA
LAAQTSIQDDDMSVAPWSLVPAGQKEALVGAAEEQCRVHEQGLTIQDIYPTTPLQEGLMALAVKQAGSYTAKLSL
ELAGADVGRFKAAWEYTLGVCAALRTRIFRHGPDTMQAVLTGPAQWQSSAIEACNMVYGSALCQYALFSRGDDTV
FSLAMHHAIFDGWSLSIIMKTLTQAYEASGNFAALEPLPPYSLFIRHVRSLDQVRAAEYWRGQLQGALSPVFPPR
PTSTCPPLSSKTVTQRIALKSASQLAVTKATILRAAWAIVLAKHNANAQDITFGAAVAGRQAPVYGIESIVGPVI
STVPIRVKLDEGQSAQDFLKAMQSQAVEMMPYEHMGIQNIAQLGADARQACDFTSLFAVQHRTILSGAQASFLTQ
SGKDGDKQQTSSYATYFTYPLVGQCYLFDDEAALELIYDGSALSDGQAEAFAAQYEHIVQQLLSVQVSGHDDLCV
GQLRLCGSWDVEKIEQWHAQEPELTLVESRIQDLIGQTASSCPDKEAILSWDGRCTYAQLEHMTCLLAQYLGAKG
VTKGSRVPICFEKSMWTIVAMMGILKAGGAFVPLSPDHPASRRRELVRDLGAKVVVVSEATQKACSDLGVRVVVL
SAGLMGELSNSDDHEQVEAMNGDDEVTPGGGAAYVLFTSGSTGKPKGVIVDHYAIASSIKGHGTAMGLGPESRVL
QFSNYIFDGSITECLATLVFGGCVCVPGDEERLGGSLSDFIQASRVNWAMLTPSFVRTLDQGHVPTLKTLVLGGE
APTRDVIEPWLGRVRLLNAYGPAEASVCIATHVIESAASPSAIGRGCNARLWIVDPEDQDCLAGVGCVGELVVQG
PGLARGYLNNEAATARAFIKAPAWLPRGAYERVYKTGDLVRYSDDGTIEYVGRKDTQIKIRGQRLESGEIEHHMR
DLLHVARQVVVTKAQIAEQDVLVAFICTTNGQTQSLDCGLAEMDDGLVRAFVALSQDLATRVPAYMVPSYFIPVR
AMPVTPTGKLNTRLLQDELLGMSVDELRQYAACQRAPFEEPRNETESRLRGLFSQVLNISESQISINDGFSQLGG
DSLKVVTLQGQIRRCFDKMLSIQLLNRRAMSIRMLAPLVLGETTDAGAAEEDFGKVLTTMLDQIWPMGNKIRQDY
VSVDFVPQAHVFLTGATGYLGTALLHRLVTESSIEKVTVLVRAKTRAQALERVKRSARLGGWWHEEFMAKLQVWK
GDLGMRGFGLSQDEWRVLTSGVHAIVHNGAAVDWSADFASLKAVNVDSTRQLVEIALASPAHPRILATARQRCSL
SFLLASVPPDYLRTKTSSQSSSQDA*
Coding >OphauB2|5225
ATGGCGCGTGGTAGCGACAACGACCCTGTGCGCGCGCTCGACGCCGAGACAATCAAGAAGCTCCAAAATGTCGAC
CAAGATTTGCGCCTAGCCCTGCCAGACTTCATGGTTCCATCCTACTACCTTCCCATCCACAAGTTTCCCCTCACA
ACCTCTGGCAAGGCAGATACGCGAAAACTGCAAGAATGGATACTCCATCTCGCCAAGCAGCAGCAGCTGGCTCCA
TACTCGCTGGCCACGCGAGCAGAGTTTCAGCGGCCCACGACGGCCATGCAATTGCGGTTGCAGAAGCTGTGGGCA
GACATCTTGGGCCTCGAGGCCGACTCGATTGGACGCGACGATAGCTTTCTTCGGCTTGGAGGAGACTCAATTGCT
GCGATTCGCCTTGTTTCTGCGGCGCGTGAAGAGGGAATACACATCACCGTGGCGTCCATTTTTCGCGACCCGCGT
CTAAGCCAGGTGGCGGCGTCTGCCATTTTGCAAGACGTCGAGGGTCAAGAGAGCAGCGTGGCACCGTGGTCATTG
GTGCCCGAGGCTCAGCAAGAGACCATGGCTGCAACAATTCGCAATCAGTGTCGTCTTGGTGCAAGCGACGAGATT
CAAGATGCGTATCCGGCTACAGCATTGCAGCAGGGCCTCATGTCACTTGCCGTCAAGCAGCCGGGGTCGTATATT
GCTCGCATGACGTTCCAGCTGCCCTCTGACATTGACGAGCATCGCTTCCGAGAGGCGTGGCAAGAGACGCTTCGA
CTGTGTCCCATTTTGCGAACCCGCATCGTCGCACAGGCAAATCAGGCCATCCAGGCAGTCATTAGCCAGCCAGCA
GAATGGGACGCGGGCGAGCTAACTAACGTCACCATGGAGCACGGCACGCGTCTCTGTCGCTATGCGCTGGTGGAT
GGCGGAGAGGGAAAGCTATTTATGCTGGCCCTCCATCACGCAATCTTTGACGGCTGGAGTTTGCCGCTAATTATG
CGAACACTGCTAGGCGCCTACCAGCACGAAACAGCGCCTGCCCTGGTTTCATATGCCAGATTCGTCAGGTACGCC
TTGGACATTGACTCGGTCAGGGCGGCTGCGTACTGGAAGGCGCAGCTGGAGAACGCTGCCCGGCCGTCCTTTCCT
CGCCGTCCCGACGCGACAGCAGGGCCAAGACGTGCTTCGAGTCAATCGCTGGCGCGCCATTTGCCCTTTGACACG
ACTGACGAGCTGCCCGTCACAAAGGCCACGGTCCTGCGAGCGGCATGGGCCATTCTCATGGCAAAGTACAATGAC
GACGCGTCCGATATTACCTTTGGCGCCACAGTCGCCGGTCGGCAGGCCGCCGTGACGGGAATCGAGGAGATTGCT
GGTCCCGTCATTGCCACTGTTCCCATTCGCATCAAGCTGGATGCGAGACAGCCCGTTGCCGAATTTTTGCATGGT
GTGCAAACCCAGGGCGCTGAAATGATGCCCTTTGAGCAGTTTGGCATGCAGAATATTTCGAGACTGGGCCCCGAC
GCAAAAAATGCCTGCGATTTTTCCTCCTTGCTAGTCATTCAGCCATTCAAGATTCTCAAGGACACGACAAACCCC
TTGTTGCAGTTTTATACTGTCGACAAGGACGACGACGATGCGGCTTCATCAGCCCTGACTGGATACTTTACCTAC
CCCCTCGTCTGGCAGTGCTGCGTCACGGATACTGAAACGGCTCTCTACGTCACCTTTGACTCGTCAGTCTTGTCG
AGGGAGCAGATTGAGACGATGATTGAGCAATTTTGTCACATTGTGCAGCAGCTCATTGCCCCCGACGCGTATAGT
CTGCAAGAGGTTACAGTGGCGGATATTTGTGTTAGCGGCACACACGACATTGCGCTGGCGCGAGACTGGAATAGT
AAAGTGTGCACCGAAATCATCTCGTCAACCTTTCATGACTTGGTGCAAGAACAGGCTCGCATTCGCCCAAATGCA
CCCGCCATTTTTGCCTGGGATGGGGAGCTGTCGTATCGCCAACTAGATGTATATTCGAACCGGCTGGCCAAGATG
CTGGTCAAGAGGCATTCGATTTGCCTGGGCGACTTGGTGCTTGTTTGCTTTGAAAAATCAGTCTTTTTTTACATT
GTCGTTTTGGCAATTAATAAAGCTGGAGGTGCGTGGGTGCCGCTGGATCCATCTCATCCCCAAACGCGACACCAA
AAGGTTACCATGCAATCTGAGGCTCGAATTGCCTTGGTTTCGCCAAAACAAGCAGACAAGTGCCGAGGATTAGTT
GCAGAAGTCATTACCGTGCCGACTGAGCTGGACCCAATGAGTCTGGATGAAGATGACGGGCCGCCGGCAGTGCAA
GTCGGACCCCAGGACGCAGCATATGTTCTCTTTACATCTGGGACAACGGGAACGCCAAAGGGAATCGTCATGGAG
CATGGCTCGCTCTGCACAAGCCAAGTCGCGAGCAGCCGGCAGCTGGGGCTAGAAGCAGAACAAGTGCGGATTTTG
CAGTTTGCAGCCTATGTATTTGACCTTTGCATCGGAGAAATTATTGGGCCTCTTATTTCTGGCGGGTGCCTGTGT
GTTCCGTCTGAATACCAAAGGATGAATGATATCGTCGGCTTCATCAACAAGGCACGCGTGAATTGGGCATATCTA
ACGCCCTCGTTTGCTCGTTTTCTCGTGCCAGATTCCGTCCCGAGTCTGCAGCTGCTTCTTTTGGCTGGTGAGCCT
GTTGGCAAGGACTTGCTTTCCACGTGGCTGGGACATGGCGTCCGGCTAGTCAATGGCTGGGGCCCGTCCGAGACT
TGCTGCTTTAGCTCACTGCTAGAATGGTCCAGTCCCGAGCAATCGCCCCTCAACATTGGCCGTCCAGTCGGCGGC
CATTGCTGGATCGTGGATCCCAGCGACCACCATCAGCTAGCTCCCATTGGGTGCATTGGCGAAGTTGTCATTCAG
GGACCAACGATTGCGCGCGAGTATCTTGCCTTTGAAGAAGGAACACGGGCCAGCTTTGTCACCGATTTACCAGCT
TGGGCGCCACGGGTAGATGAGCACTATGCAAGATTTTACAAGTCTGGAGACTTGGCCTACTATAATGCCGATTCC
ACCATGGAGTTTGTTGCACGCAAAGATACCCAGGTAAAGGTTCGTGGATTCCGGGTCGAATTGGGCGAAGTTGAG
CACCATGTACGACTAGGCTTGCCCGAAGCGCGGCAGGTGGTTGTTGATGTGCTTGCCGCCAGCGAAAGCGATGCT
ACTGCAAAACTAGTGGCCTATTTGTGTTTCTCGTCGGCAACGTCGAGTCCCGATGATGAGGGCGAGAACAACAAG
AACATGATGATGGCGCTTGATGAAGCGCTCTCGAAAAAACTATTGGAGCTCAAGGCCTATCTCGAGGTGCGGCTG
CCGCAGTATATGGTGCCCGCCGTCTTTATCCCTATTAGGCATGTGCCCTTTATCACGTCGCACAAGATTAATCGC
AATTTGCTTCGCACGGTGACGCGAGAGCTTTGCGCTCAGGAATTGGCGCCATATATGCTTTCCAATACGGAAAAG
GAGGCCCCTGCAACGGAGCACGAGGTGGCGATGCAAAAGCTATGGGCAGAAGTGCTTCACGTACCAGTTGAGCTT
ATTGGTCGGCACGATAGCTTCCTTCAGCTTGGTGGCGATTCCCTCTCGGCGATGCGTCTAGTATCAAAGGCGTAT
GAAGCGGGAATCCAGCTAAGTGTTGGGTCCATCTTCAAGGACGCTCGACTTGCTCAAGTGGCAGCGGCTGCGTGT
TTTGACGACTCGAGGCGTCATGTTGTACCCGAGCCCTGGGAACTAATTGAGGATAGCAAACGTGACAGGATGGAA
CAAGTAGTCAGACAGCAATGCGGCTTGTCCGACAGCGACATTATCTCAGATGTTTACCCGGCGACTGCGCTCCAG
GAAGGGCTGATTGCCTTGGCGAGCAAGCAGCCCGGATCCTACATGGCTGGCTTTACCTTTGAGCTGACTACTGGG
ACGTCGGTGCAGCGCTTCAAGGATGCATGGGAAAAGACGCTAGCAAGATGTCCTGCGCTGCGCACGCGAATTGTG
CTGTGCAGCGACGAAACGATTCAGGCGGTGCTTGAGCGTCCAGCTAGCTGGGGAAAAGAGGGCGAGACTATGATG
ATTATGGGATACGGAACGCCTCTGTGCGCTTACTCGCTGACCAAGAAAGGCGATGAGAGCCTCTTTAGCCTCACG
ATGCACCACGCCATTTTTGATGGATGGAGTCTGGGCGTCATTATGCGCATCTTGTCGCAAGAGTATGATGGACAA
ACAGCCTCACTCTCCCCTCTGACTCCCTATGTCAGCTTCGTCAAGTACACACTCGCCCTTGACGAGGAAAAGGCA
GCAGAGTATTGGCGCGGACAACTGGCGCAATCGCTACGGCCCGAGTTCCCGCCAAGAGATACTCGGCCGGCTGCT
TCAACATCTGCACAGGCTCATGACAGCCACGTGGTGAGGCATCATTTTGCCTTTGATATGAAGAGCCAAAGGCTG
GTGACCAAGGCCACGGTGTTGCGGGCGGCGTGGGCCGTGGTTATGGCGCGGTACAATAACGCCGATAACATCACC
TTTGGCGCAGCAGTAGCTGGACGGCAGGCATCCGTGGCTGGAATCCAAGACATTGTCGGGCCAGTCTTGTCAACG
GTGCCTGTGTGCGTTGGCGTGTCGGCTGGACAGACGGTCAAGGATTTCCTGTTGGCGGTACAGGCGCAGGCTGTG
GGCATGATTGCCTTTGAGCACATGGGCCTGCAAAACATTGGTCGCCTGGGACCCGAAGCTCGCGATGCCTGCGAC
TTTTCGTCCATGTTTTCCGTTCTTTATAGTTCTATTGTGTCGGATGTGCAGACGAGCATCCTCAAGGCGAGCCCG
AGCAGCAATGCCTCGACCGACTTTGGCACTTACTTTACCTATCCGCTCGTGGCCCAGTGCTTCTTGTCGGAGCAA
GAGGCCATTCTCGAGCTCGTGTATAACTCGTCGTCGTTGTCGCGGGCGCAGGTTGAGGCCATTGCCGCACAGTAT
AGCCATGTGGTTGAGCAGCTCTTGTCGATGCAGTCGGCCGACGACGAGACGGTCCTGGCAGACGTGACGCTGTGT
GGCGAATGGGACATGTCGCGCATCAAGCAGTGGCATGATGCTCTGCCGCCCATTCGGCCTGTCGAAGCATGCATC
CACCACCTCATTTCAGCCACAGCTGCCGAGACGCCTGAAAAACAGGCCCTTTATGCGAGCAAAGAAAGCTTCACC
TATGCTGAGTTTGACGATTTGACAAGCAAGCTGGCTTGGCACCTCGGCAGGCTGGGCGTTGGGCGCGGCTCCCTC
GTTCCATTTTCCTTTGAAAAGTCGCCGTGGGCCATTATTGCCATGCTGGGCATCCTCAAGGCTGGCGGCGCCTTT
GTGCCATTGAACCCGAATGATCCCATTGCTCGCCAGAAGACGCTTTTGGCTGACTTGGGTGCCGAGCTTTTGCTT
GCTTCGTCATTGACTGCTGAGAGATACGGCGAAACTGGCATCTCTGTCGTTGTGGTGACTTCAAGTCTCTTGTCG
TCACTATCGAGTCAAGCAAGTAGTAGACATGACGAGCGCAGCATAGTCGGGCCACATGACATTGCCTATGTGCTA
TTTACCTCTGGAAGCACTGGAACGCCAAAAGGAGTCGTGGTTGAACATTGGTCCCTCTCTTCGATTGTGTCGCGC
CGCCCAGACTTAGTCACCTTCGGGGCGGATTCTCGCGTCTTGCAATTCTCGAAATTTGTCTTTGACGTTAGCTTG
GAGGAAATCTTTGCGACGCTCCTCTTTGGAGGCACACTCTGTATCCCATCTGAGGAGCAACGAATTGACGACTTG
GCCAACTTTATAAACGAGGCCAATGTCTCGTGCGCTATGTTGACGCCCTCGGTTGCGCGCCTCATGACGCCGGCA
CAAGTACCACAACTCAAGACGCTGCTGGTGGCTGGAGAGCCTCCGTCCATGGACCTTGTTGAGACATGGTCGCGC
AGTGTCGAGTTGTGCAATGACTATGGGCCGGCCGAAGCCTGTGTCTACGTGGCTTCGCATCTGATGCGGCCCACG
GCACAGTCGGCCTCGACAATTGGTCGTGGCTGCAACTCTCGGCTTTGGATTGTTGATGCCGAGAACCATGACCGT
TTGGCGCCTGTTGGGTGCATTGGCGAGTTGATGATTGAGAGTCCAGGCGTTGCTCGTCATTACCTAAACGATGCG
ACCAAGACGGAACAAGCATTTTTCCAGGGCACCTCGTGGCTCCCGCGAGATGGCCAGAGACACAGAATTTACAAG
ACTGGAGATCTCGTGCGCTACAACCTTGACGGAACCACTGAAGGTGACGGCACCATTGAATACATTGGCCGCAAG
GATGGCCAGACCAAGATTCGTGGGCAGAGACTGGAGATTGGCGAGATTGAGTACCACATCAACCACCAGCTTGGG
CCACAGTCGACCTCATCAGTGCAGCTGGTTCAGGTCGAGGGCAACGCTGCCTTGTTTGCCTTTGTCTCGACCCAA
GGAAAAACAGGCACTGACGAGACCGAGGCCATTGCGCCGCTGGACAAGAGCACATTGCACTTGCTACGGAATCTG
CATCAAGGCCTGCAATCAATCTTGCCCTCGTACATGCTTCCTTCCTACTATCTGCCCATTGCCTACTTGCCTCTG
TCTGCTTCGGGCAAGACAAATGGTCGAGCGCTGCGGCAGTGGGTCAAGCACTTGTCTGCCGAGCAGCTTGCCGAC
TATTCGCTGATGCAGCAGGTCGAGTTTGAGTCACCCGTCACTGACATGGAAATTGCGCTTCAGAGGCTGTGGGGG
AGTGTTTTGAAGTACCCCGCGGAAAAGATTGGCTTGAATGACAGCTTCCTTGAGCTCGGGGGCGATTCTATTCGT
GCCATTCGTCTCATTGCTGCTGCGCGTGAAGAGGGTATTATGCTGACCGTGTCAGCCATATTTCGCGATGCTCGT
TTGCGAATGGTGGCTGCAGCCGCAACTACTGGCCAACGGGATACCGTGGACGAGGGCAATGCAGAGCCATTGAGT
CTATTACCACCACACGACCTTGTCGACATTACCAATACAGTCCGTCAGCAGTGTTCGCTATCGGCAAATGATGTA
ATTCAAGACATTTATCCAGCAACCCCACTCCAGGAAGGTTTGATGGCGTTGGCTACCAAGAAGCCGGGTTCATAT
ACGGCTCGATTTGTCTACCAGCTGGCGCCACACGTCGACGTTGATCGCTTTACTATTGCGTGGCAGCACGTTGTG
CGCCTATGCAGCACGCTACGCACCAGAATTGTAATGTGTGGTGAGCGGACGGTGCAAGCTGTTGTGCAGGAGCCA
GCACATGCTTCTAACCTGGACAAGGTGGAATATGGAAGCCCCCTGTGTCACTGCTCTATTGAGAGTCGTGGAGAT
GAGACACTGTTTAAACTAGTCATGCACCATGCTATTTTTGACGCATGGTCACTGGGCCTCATTCTCCAGCTCCTA
ATCAAGGCGTACCACGATCCTCAATCCGTGCTGCCACCGCCTCCCTACGCCAACTTTGTGCGGTATACCCTCAGC
CTAGACTTGCCGCAAGCATCCGAATACTGGCGCAAGAAACTCGAAGGCGCATTAAGGCCAGTCTTTCCGCGACGA
TCAGGACCCTTGGTACAAGCGAGCGGCGGCGATGCACCGAGCTGTTCAAGCAAAGTGCTGCTTCATCGTGTGCCT
TTTGAAATAGACGGCCAGCTGCCCGTTACCAAGGCGACCGTCTTGCAAGCTGCATGGGCCATTGTGCTTGCCCAG
TATAATGATGACGCCGAGGATATCGTCTTTGGAGCCGTGGTTGCAGGCCGACAGGCTCCGGTAGCAGGTATTGAG
ACAATGATTGGCCCCGTGCTATCGACGGTGCCTATTCGAGTCTCTTTGCCACGACGGCAGCCTGTACAAGACGTG
TTGCTTTCAATCCATGCCCAGGCGAATGAAATGGTACCCTTTGAGCACTTGGGAATTCAAAACATTTCAAAGTTG
AGCAAGGATGCGCAAGACGCGTGCGATTTTTCGTCTCTATTTACAATTCAGTATGGCGCTGCCGACTCGCAGTCC
GAGACACCCTTTTTGATACCAGTCTTTGATGCGGACCGGTCGACCGATTTCAACACTTATTTTACCTATCCACTC
GTGGGCCAGTGTTGTCTATTGGATCGAGAAGCTCAACTGCAGCTTGTATACGACTCGTCGGTCCTGTCAGAGCCT
CAAGTTGCTCGCCTAGCTGCGCAGTACGAACGCACCGTTCAGCAGCTTCTTTCTATTCAACATGAGGGTCCAGGG
CAGTGTCTCACGCTTGACAAGGTCAATATATGCACCGATTGGGATAAGCAGGCGATTGAGCAATGGAATAGCAGC
GACCCAGAGTTGATGGCTGTCAATGAATGCGTGCATGAGCTTATTGCAAAACGTGCAGCGCAAATGGGCGATGAA
GAAGCAATCTTCTCTTCTGACGGTTGCTGCACTTACAAGGAGCTGGACAAGATGACGACACTTGTCGGCAATTAC
TTGCAGAGCCAGGGCGTTGGCATCGAATCGCTTGTTCCGATTTGCTTTGAAAAGTCCATGTGGACGATTGTGGCA
ATGATTGCTGTTATGAAGGCTGGCGGCGGCTTTGTGCCCCTAAACCCAGACCACCCTATTCAGCGACGTCAACAG
CTAGTCACCGCTCTCAAGGCCCCGCTAATGCTTGTTTCGCCAAGCACGTTTGACATTTGCCAAGAGATGGATGTC
CCTCTAGTCACGATTTCAGCAGACTTTGTTGCCTCGTTGCCGGAAAGCGTCCACTCGCATGATGCTGTGCCGAGC
AATATAGCATATGTTCTTTTTACCTCGGGCAGCACAGGTGCACCCAAGGGCGTGGTGATTGAGCACCGTGCCATT
GCATCTAGTATATTTGGACATGGTGTCGCCATGGGCATTGAGTCTGGTACCAGAGTTTTGCAATTCTCCAACTAT
ATCTTTGATGGCTCGATTACGGAGTGCCTTGCAACGCTTGTTCTCGGAGGAACAGTCTGCGTCCCTTCTGATGGG
GAACGCCTCGATGGCTTACAGAATTTCCTGGTCAATGCCAGGGTAGACTGGGCCATGCTGACGCCGTCTTTTGTA
CGAACGCTCAACAGAGAGCAGGCGCTTAAAACTCTCAAGACGCTTGTGCTGGGAGGCGAGGCGGTGCCACAAGAT
GTAGTCGATGCATGGGCTGGTCGGGTCAATCTCATCAATGCCTATGGCCCGGCAGAAGCATCAGTGTGTATTGCG
ACGCACACTGTACAAAATTCGACACAGCAACAGTCTCCGCGAACCATTGGGCGCGGGCGCAATAGCCGTCTGTGG
ATTGTTGACGCTCAGAACCACGACCGGCTTGCCGCTGTGTATTGCATTGGAGAGTTGGTTGTGCAAGGACCTAGT
CTTGCGAGGGGCTATCTTAATGACGAGAAGAGGACGCAGCAAGCATTTATACAAGCAACATCGTGGTTGCCATTT
GGCGAGCACCAGCGACTCTACAAGACTGGCGACTTGGCCCGGTATAACAGCGACGGCACCATTGAGTACATGGGG
CGCAAGGACAGCCAAGTCAAGCTACGGGGCCAGCGGCTCGAGCCAGGCGAAGTCGAGTTTCATATCAAGCAAATC
CTGGGCTCACAGTTTGGCTGCTCTGTTCAAATCGCGCGGGATGCACTCTTTGCTTTTATTTGCACAGCAGGGCCA
GTGCAACAGACTGGCAAGGCAACCAGTCCTGGCAGCGAGGGAAACTGCATCTTGGGTGTGGACAAGGAGGTGCGG
CAGCTGTTTAACAAGCTTCAAGAGAGTCTTCGATTGGCATTGCCTGCCTTTATGGTACCATCATACTACCTCTCA
GTCTCACAGTTGCCATTAACAGCCTCTGGAAAGATTGATGGCAACGCCTTGCAAGCATGGGCTCTTGGCTTGTCG
ACAGAAGACTTGGTGCAGTCATCTCCATCAGTTCAAGTCGAATTTGAGCCTCCAGAGACGGAAATGGAGGGCGAG
CTACAAAAGCTATGGAGCCAAGTCCTGGGAGTATCACCAGACAAGATTGGCCGCAGCAATAGCTTTCTTCAACTT
GGAGGCGACTCCATTACTGCGATTCGCCTAGTAGCAGCAGCTCGCGAGAAACACATTAGTCTGAGCGTTTCCTCC
ATTTTTCAAGACGCGCGGCTCAAACAAGTGGCAGCATTGGCGGAATTCCAAGATTTATCCAAGAATGACGAGGCC
ACGCTGGAGCCGTTTGCCTTGGTTTTATTGGATAAGTGTGAGGAGCTTTGTCAAGCGGTTCGTGAGCAGTGCGCA
CTCGCTGCAGACGAAACAGTCCAAGACGTCTTTCCGACGATTCCTTTGCAAGAGGGTCTCATGGCGCTTGCGGTG
AAGCAGCCTGGATCTTATATGGCTCGCTTCGTGTTTGAGCTGGCTGATCAAGTTGATGTTGGTCGCTTCAAGGCG
GCTTGGGAGGCGACTCTGACAAGGTGCGCGGCACTAAGGACGAGAATTATTATCCACAATGGCCAAACTCTTCAG
GCTATTATTCAACAAGCACCAGACTGGAAAGATGCAAACTCGGCGCAGCTGAGAATGGCGTATGGAACGCCGCTA
TGCCGCTACTATTTGGCAAGCCGCGGCAGCAAGAAGCAATTTGTCCTAACGATGCACCATGCTATATTCGATGGC
TGGTCCTTTGGAATCATTATGCGGACGCTTTTGCAAGCCTATCAAGGGATTATCTTTTCAACACCATTGACTCCC
TATGCTGGCTTTGTAAAGTACGTTGTCGAGTTGGATGTGGAGCGCGCTGCAGAGTTTTGGAATGAGCAGCTGGAT
GGAGCCTTGCAGCCCGTCTTTCCTCGTCGAGCCGCAGCATCATCGCGTCTAGTAGACGCTGCTACAGCAAGTCGG
ACTCTGGTGCACCAGGTGCCCTTTGAGGCGCCGCCTGCAATGTCAGTGACCAAGGCAACCGTGCTTCGAGCAGCA
TGGGCCATTACTCTTGCGCGCTACAACGATGGCACCGATGACATTACGTTTGGAGCTGCCGTGGCTGGTCGTCAG
GCCCCCGTGTCTGGCATTGAAGGCATGGTTGGGCCAGTCATTTCGACGCTGCCAGTCCGTGTAAAGTTGAATTCG
CAACAGCGAGTCGGCGAGTTTCTTGGAGACTTGCAGTCGCAAGCCACAGACATGATGCCCTTTGAGCACATGGGT
CTACAAAATATTGCAAAGCTTGGGTCTAGTGCGCGCGAGGCATGCGATTTTTCCTCGCTCTTGGTCATTCAACCA
CAAGCAATTACGGGTGATGTGGAAAGTGGTTTTCTAAAACTACGTCGCACCGATGCGGATGACGATCAGTATTTT
AGCTACCCGCTTGTTTGGCAGTGCTATCTGGCGGGCGACCAAGTCCACTTGCACGTTACATATGACTCGTCTGTG
CTGGGCGAGAAGCAAGCGTCGTTGATGGCTAATCAGTTTTGCCACGTTGTCGAGCAGCTCCTGGCACCAGACGTG
CACCTTGAGACCAGCAGCGTCGTGGTCGGTGATGTGACTCTCTGCGGGCCTCGGGACTTGGCCATTGTTACGGAG
TGGAACAAGAAGCGCCAGGCCGAGATTGTCTCTTCGACTTTGCACGAGTTGGTGGCGAAGCAGGCGAGGATGCGT
CCGTCTTGTCCAGCCATTTATGCGTGGGACGGCCAGCTGAGCTACCAAGAGCTGGATACCATCTCGACACGATGG
GCTACCTATCTCTCCTACAAGTATCATGTCAAATCCGAGGAGCTGGTGCCGCTGTGTTTTGAAAAGTCACTCTGG
TTCTACGTTGCCATGCTTGCTGTCAATAAGGCTGGTGGTGCTTGGCTGCCTCTAGACCCCTCACACCCTACACAT
CGGCACCAGGTGGTTGTCAAGCAAGCCAAGGCCCGCATAATTTTAACGTCGCCAACGGCAGTGGAAAAGGCCCGG
GGCCTGGCGCGGCATGTGGAGGTGCTTTCCCCCGAGGCTGACAAGGCTGTCACAGAGACGCTACGCGACAATGGC
ATTGCCCTGTCGGTCAAGGCTGTGCAGCCAAGCAACATTGCCTATGTGCTATTTACGTCTGGAACAACGGGCACG
CCCAAGGGAATGGTTATGGAACACGGAGCCTTGTGTTCAAGCATGACTGCTTCGAGTAAAAGACTGGGAATCGAC
CCAGACAATGTGCGCCAACTACAGTTTGCGGCCTATGTGTTTGATTTGGCCATTGGCGAAATCATACCTGCGCTC
ATCTCGGGCGCTTGCATTTGTGTGCCATCTGAGCACCAGCGCCTCAATGACTTGTCGAGCTTTGTGGCTGAGTCG
AGGGCAAATTGGGCCTATCTGACGCCTTCATTTAGTCGCATCCTGTCTCCGACAGACGTGCCCGGTCTTGAAGTC
CTCATGTTTGCGGGTGAGGCAGTTGGCACGGACCACTTGGCCAAGTGGTTTGGCCGTCTTCGTCTCATCAATGCA
TGGGGTCCATCAGAGGCGTGTTGTTTTGCATCATTCCGCGAGTACGAGACGGTGGACGACTCGCCTCTAAACATT
GGATTTCCAGTGGGAGCGCGAAGCTGGATTGTTGAACCAGACGACTACCACCGTCTGGTGCCAATTGGCTGTGTT
GGAGAGATTATGCTGCAGGGGCCGACTCTAGCCCGGGAATACCTGGCTTTTGAAGCGGGCACCAAGGCTAGCTTC
ATTACAGACTTGCCCGAGTGGGCGCCAGACAGGGAGCAAGTGCCGTACTCGCGGTTTTACAAGTCGGGCGATCTC
GGATACTATAACGCTGATGGAACCATGGAATTTGTGGCGCGCAAGGACACTCAAGTAAAGATTCGCGGCTTCCGC
ATCGAGTTGGGAGAGGTTGAAAGTCAGGTTCGCAATGCGGTTGGCGGCATTCAACAGGTGACTGTCGATGTTCTA
AAGTCGCAAGGAGTTGATCGGCTCGTGGCCTATCTATGCTATTCCTCGGCGATGCGAACACCTGAGAGTGGCAAT
TCAGACTTTTCAGACTTGCTGCTCCCCATGGACGAAACAATGACACAAGAGGCCGCTAGTCTCAAGAGTTTTCTC
CAAGTAAGACTTCCCTTGTACATGGTGCCAACAGTTTATATCCCTGTGCGGTATATGCCCTTTATTACATCGCAA
AAGACGGATCGCAGGATACTGCGACAGACGGCGAGTTCCATTTCCAATGCAGAACTGGAACAGTACATGTTGGCA
AATGCCACCAAGGAGCCGCCAGCCACAGCCATGGAGACGCTTTTGCAGAGTCTCTGGGCCGACGTCTTGTCTATT
CCGACGGAGCGAATTGGCCGCAACGACAGCTTTTTGCATCTAGGCGGCGACTCACTTGGCGCAATTCGCCTCATT
ACCAAGGCCCGACAACATGGCGTGCAACTGAGCGTGGCAAACATTTTCAAGGATGCTCGCTTGAGTCAAGTGGCG
CTGGCTGCGCAAACGAGCATACAGGACGACGACATGTCTGTCGCTCCCTGGAGTCTGGTGCCGGCAGGGCAGAAA
GAGGCTCTTGTTGGCGCTGCTGAGGAACAGTGTCGGGTGCATGAGCAAGGTTTGACGATTCAAGACATTTATCCC
ACGACGCCGCTGCAAGAGGGTCTCATGGCATTGGCTGTGAAGCAAGCCGGATCCTACACAGCCAAGCTCAGCTTG
GAGCTTGCCGGTGCCGACGTTGGCCGCTTCAAAGCAGCCTGGGAATACACTCTTGGTGTGTGTGCGGCTCTCCGA
ACGCGAATCTTTAGACATGGGCCAGACACAATGCAGGCCGTTCTCACAGGCCCGGCACAGTGGCAATCGTCGGCC
ATTGAGGCATGCAACATGGTGTACGGATCCGCACTCTGCCAATATGCTCTGTTTAGTCGAGGCGACGACACCGTC
TTCTCCTTGGCTATGCATCATGCTATTTTTGATGGATGGAGCTTATCAATTATTATGAAGACGCTGACGCAGGCC
TATGAGGCTTCCGGCAATTTTGCTGCTCTTGAGCCTCTTCCGCCCTACTCGCTCTTTATCCGCCATGTACGCAGC
CTGGACCAGGTGCGAGCAGCCGAGTATTGGCGTGGACAGCTTCAAGGGGCCCTGTCTCCAGTATTTCCCCCACGG
CCAACCTCGACATGTCCGCCCTTGTCGAGTAAAACAGTGACGCAGCGCATTGCGCTCAAGAGTGCGTCTCAGCTT
GCAGTAACAAAGGCTACCATTCTCCGCGCTGCCTGGGCCATTGTTCTCGCCAAGCATAATGCCAATGCACAAGAC
ATTACGTTTGGGGCGGCAGTGGCGGGCCGCCAGGCGCCAGTCTATGGCATTGAGAGCATCGTGGGACCAGTCATT
TCCACGGTGCCAATCCGCGTCAAGCTGGATGAGGGGCAGTCTGCACAAGACTTTTTGAAGGCGATGCAAAGCCAA
GCGGTTGAAATGATGCCCTATGAGCACATGGGTATTCAGAATATTGCCCAACTTGGTGCTGATGCGCGTCAAGCC
TGCGACTTTACCTCTTTGTTTGCCGTTCAGCACCGCACTATTTTGTCGGGCGCACAAGCCTCCTTTTTGACCCAG
TCTGGCAAGGACGGGGACAAGCAGCAGACGTCTAGCTATGCGACTTACTTTACCTATCCGCTCGTGGGACAGTGC
TACCTGTTTGACGATGAAGCTGCGCTTGAGCTCATTTACGATGGCTCCGCGCTCTCGGATGGACAGGCTGAGGCG
TTTGCCGCTCAATACGAGCACATTGTGCAACAGCTCTTGTCTGTACAAGTATCTGGACACGACGACTTGTGTGTT
GGACAGCTAAGGCTGTGTGGCAGCTGGGACGTGGAAAAGATTGAGCAGTGGCACGCGCAGGAGCCAGAGTTGACA
TTGGTTGAGTCGAGGATCCAAGACTTGATTGGCCAGACTGCCTCGTCTTGTCCCGACAAGGAGGCCATTTTGTCG
TGGGATGGGAGGTGTACATATGCTCAACTAGAGCACATGACTTGCTTGCTGGCCCAGTATCTGGGTGCAAAGGGG
GTGACGAAGGGATCGCGCGTGCCGATTTGTTTTGAAAAGTCCATGTGGACCATTGTGGCCATGATGGGCATATTA
AAAGCGGGAGGGGCGTTTGTGCCGCTGAGTCCAGATCATCCGGCGAGTCGAAGGCGAGAGTTGGTGCGTGATTTG
GGGGCAAAAGTTGTCGTTGTTTCCGAGGCGACGCAAAAGGCGTGTAGTGATTTGGGGGTGAGGGTGGTTGTGCTG
TCGGCGGGGTTGATGGGTGAGCTTTCGAATTCTGACGACCATGAGCAAGTCGAGGCTATGAATGGAGACGACGAA
GTGACGCCTGGTGGAGGCGCGGCATATGTGCTCTTTACCTCTGGCAGCACGGGCAAGCCCAAGGGCGTCATTGTC
GACCACTATGCCATTGCATCGAGCATCAAGGGCCACGGCACTGCCATGGGCCTGGGACCCGAGTCACGAGTCTTG
CAGTTTTCCAACTACATCTTTGACGGATCCATTACCGAATGCCTCGCAACCTTGGTGTTTGGCGGTTGTGTGTGC
GTGCCTGGTGACGAAGAGCGACTCGGAGGATCTCTGAGCGATTTTATCCAGGCTTCACGCGTCAACTGGGCCATG
CTTACCCCGTCGTTTGTGCGGACTCTAGACCAAGGCCATGTGCCCACGCTCAAGACGCTGGTGCTTGGAGGTGAA
GCACCAACACGAGACGTTATTGAGCCCTGGCTTGGACGGGTGCGTCTGCTGAATGCCTATGGACCAGCAGAGGCG
TCGGTCTGCATTGCCACCCATGTCATTGAATCAGCAGCCTCACCGAGCGCAATTGGACGCGGGTGCAACGCTCGA
CTGTGGATCGTGGATCCCGAGGACCAAGATTGTCTGGCTGGTGTGGGATGTGTTGGCGAGTTGGTGGTGCAAGGG
CCAGGGCTTGCTCGAGGCTATCTCAACAATGAAGCAGCAACGGCGCGTGCCTTTATCAAGGCTCCGGCCTGGCTG
CCTCGAGGTGCGTATGAGCGCGTCTACAAGACTGGCGATCTTGTGCGGTACAGCGACGACGGCACGATTGAATAT
GTTGGTCGCAAAGACACGCAAATCAAGATTCGCGGCCAGCGGTTAGAGTCGGGCGAGATTGAACACCACATGCGC
GATCTGCTCCACGTGGCGCGCCAGGTTGTCGTGACAAAGGCCCAGATTGCTGAGCAGGATGTCCTGGTGGCCTTT
ATTTGCACGACGAATGGCCAGACGCAGTCGTTGGACTGTGGCCTTGCCGAAATGGATGACGGGCTTGTCCGGGCG
TTTGTCGCCTTGTCGCAAGATTTGGCCACGCGCGTGCCGGCATACATGGTTCCCTCGTACTTTATTCCCGTGCGG
GCCATGCCCGTGACGCCAACCGGGAAACTCAACACTAGGCTTCTTCAAGATGAGCTTCTCGGCATGAGTGTGGAT
GAGCTGCGGCAGTATGCAGCGTGCCAGAGGGCTCCCTTTGAGGAGCCGCGCAACGAGACGGAATCTCGATTGCGG
GGCCTATTCTCTCAGGTTTTGAATATCTCGGAATCGCAAATCAGTATAAACGATGGGTTTAGCCAGCTTGGTGGC
GATTCACTCAAAGTCGTGACATTGCAGGGCCAGATTCGGCGGTGCTTTGACAAGATGTTGAGTATTCAGCTGCTC
AACCGCCGGGCCATGTCTATTCGCATGTTGGCTCCCTTGGTACTGGGCGAGACGACGGATGCTGGTGCCGCCGAG
GAAGATTTTGGAAAAGTACTCACAACCATGTTGGATCAAATCTGGCCCATGGGCAACAAGATTCGGCAAGACTAC
GTTTCGGTTGATTTTGTACCGCAAGCTCACGTCTTTCTTACGGGCGCAACGGGATATCTCGGCACGGCTCTCCTC
CATCGCTTAGTGACGGAGTCGAGCATTGAGAAAGTGACTGTGCTTGTGCGAGCAAAGACGCGGGCCCAGGCTCTA
GAGAGGGTCAAACGGTCGGCTCGACTTGGCGGCTGGTGGCACGAGGAATTCATGGCCAAGCTGCAAGTGTGGAAG
GGAGACTTGGGCATGCGTGGCTTTGGCCTGTCGCAAGATGAGTGGAGGGTGCTGACGAGTGGAGTGCATGCCATT
GTGCATAATGGTGCGGCGGTGGATTGGAGTGCTGATTTTGCGTCTCTCAAGGCGGTTAATGTGGACTCGACGCGG
CAACTTGTTGAGATTGCACTGGCGTCGCCGGCGCATCCCAGAATCTTGGCTACAGCCAGACAAAGGTGCTCTCTG
AGCTTCTTGTTGGCGAGTGTGCCGCCCGACTACCTGCGCACCAAGACCAGCTCTCAGTCGTCAAGCCAGGACGCA
TAA
Transcript >OphauB2|5225
ATGGCGCGTGGTAGCGACAACGACCCTGTGCGCGCGCTCGACGCCGAGACAATCAAGAAGCTCCAAAATGTCGAC
CAAGATTTGCGCCTAGCCCTGCCAGACTTCATGGTTCCATCCTACTACCTTCCCATCCACAAGTTTCCCCTCACA
ACCTCTGGCAAGGCAGATACGCGAAAACTGCAAGAATGGATACTCCATCTCGCCAAGCAGCAGCAGCTGGCTCCA
TACTCGCTGGCCACGCGAGCAGAGTTTCAGCGGCCCACGACGGCCATGCAATTGCGGTTGCAGAAGCTGTGGGCA
GACATCTTGGGCCTCGAGGCCGACTCGATTGGACGCGACGATAGCTTTCTTCGGCTTGGAGGAGACTCAATTGCT
GCGATTCGCCTTGTTTCTGCGGCGCGTGAAGAGGGAATACACATCACCGTGGCGTCCATTTTTCGCGACCCGCGT
CTAAGCCAGGTGGCGGCGTCTGCCATTTTGCAAGACGTCGAGGGTCAAGAGAGCAGCGTGGCACCGTGGTCATTG
GTGCCCGAGGCTCAGCAAGAGACCATGGCTGCAACAATTCGCAATCAGTGTCGTCTTGGTGCAAGCGACGAGATT
CAAGATGCGTATCCGGCTACAGCATTGCAGCAGGGCCTCATGTCACTTGCCGTCAAGCAGCCGGGGTCGTATATT
GCTCGCATGACGTTCCAGCTGCCCTCTGACATTGACGAGCATCGCTTCCGAGAGGCGTGGCAAGAGACGCTTCGA
CTGTGTCCCATTTTGCGAACCCGCATCGTCGCACAGGCAAATCAGGCCATCCAGGCAGTCATTAGCCAGCCAGCA
GAATGGGACGCGGGCGAGCTAACTAACGTCACCATGGAGCACGGCACGCGTCTCTGTCGCTATGCGCTGGTGGAT
GGCGGAGAGGGAAAGCTATTTATGCTGGCCCTCCATCACGCAATCTTTGACGGCTGGAGTTTGCCGCTAATTATG
CGAACACTGCTAGGCGCCTACCAGCACGAAACAGCGCCTGCCCTGGTTTCATATGCCAGATTCGTCAGGTACGCC
TTGGACATTGACTCGGTCAGGGCGGCTGCGTACTGGAAGGCGCAGCTGGAGAACGCTGCCCGGCCGTCCTTTCCT
CGCCGTCCCGACGCGACAGCAGGGCCAAGACGTGCTTCGAGTCAATCGCTGGCGCGCCATTTGCCCTTTGACACG
ACTGACGAGCTGCCCGTCACAAAGGCCACGGTCCTGCGAGCGGCATGGGCCATTCTCATGGCAAAGTACAATGAC
GACGCGTCCGATATTACCTTTGGCGCCACAGTCGCCGGTCGGCAGGCCGCCGTGACGGGAATCGAGGAGATTGCT
GGTCCCGTCATTGCCACTGTTCCCATTCGCATCAAGCTGGATGCGAGACAGCCCGTTGCCGAATTTTTGCATGGT
GTGCAAACCCAGGGCGCTGAAATGATGCCCTTTGAGCAGTTTGGCATGCAGAATATTTCGAGACTGGGCCCCGAC
GCAAAAAATGCCTGCGATTTTTCCTCCTTGCTAGTCATTCAGCCATTCAAGATTCTCAAGGACACGACAAACCCC
TTGTTGCAGTTTTATACTGTCGACAAGGACGACGACGATGCGGCTTCATCAGCCCTGACTGGATACTTTACCTAC
CCCCTCGTCTGGCAGTGCTGCGTCACGGATACTGAAACGGCTCTCTACGTCACCTTTGACTCGTCAGTCTTGTCG
AGGGAGCAGATTGAGACGATGATTGAGCAATTTTGTCACATTGTGCAGCAGCTCATTGCCCCCGACGCGTATAGT
CTGCAAGAGGTTACAGTGGCGGATATTTGTGTTAGCGGCACACACGACATTGCGCTGGCGCGAGACTGGAATAGT
AAAGTGTGCACCGAAATCATCTCGTCAACCTTTCATGACTTGGTGCAAGAACAGGCTCGCATTCGCCCAAATGCA
CCCGCCATTTTTGCCTGGGATGGGGAGCTGTCGTATCGCCAACTAGATGTATATTCGAACCGGCTGGCCAAGATG
CTGGTCAAGAGGCATTCGATTTGCCTGGGCGACTTGGTGCTTGTTTGCTTTGAAAAATCAGTCTTTTTTTACATT
GTCGTTTTGGCAATTAATAAAGCTGGAGGTGCGTGGGTGCCGCTGGATCCATCTCATCCCCAAACGCGACACCAA
AAGGTTACCATGCAATCTGAGGCTCGAATTGCCTTGGTTTCGCCAAAACAAGCAGACAAGTGCCGAGGATTAGTT
GCAGAAGTCATTACCGTGCCGACTGAGCTGGACCCAATGAGTCTGGATGAAGATGACGGGCCGCCGGCAGTGCAA
GTCGGACCCCAGGACGCAGCATATGTTCTCTTTACATCTGGGACAACGGGAACGCCAAAGGGAATCGTCATGGAG
CATGGCTCGCTCTGCACAAGCCAAGTCGCGAGCAGCCGGCAGCTGGGGCTAGAAGCAGAACAAGTGCGGATTTTG
CAGTTTGCAGCCTATGTATTTGACCTTTGCATCGGAGAAATTATTGGGCCTCTTATTTCTGGCGGGTGCCTGTGT
GTTCCGTCTGAATACCAAAGGATGAATGATATCGTCGGCTTCATCAACAAGGCACGCGTGAATTGGGCATATCTA
ACGCCCTCGTTTGCTCGTTTTCTCGTGCCAGATTCCGTCCCGAGTCTGCAGCTGCTTCTTTTGGCTGGTGAGCCT
GTTGGCAAGGACTTGCTTTCCACGTGGCTGGGACATGGCGTCCGGCTAGTCAATGGCTGGGGCCCGTCCGAGACT
TGCTGCTTTAGCTCACTGCTAGAATGGTCCAGTCCCGAGCAATCGCCCCTCAACATTGGCCGTCCAGTCGGCGGC
CATTGCTGGATCGTGGATCCCAGCGACCACCATCAGCTAGCTCCCATTGGGTGCATTGGCGAAGTTGTCATTCAG
GGACCAACGATTGCGCGCGAGTATCTTGCCTTTGAAGAAGGAACACGGGCCAGCTTTGTCACCGATTTACCAGCT
TGGGCGCCACGGGTAGATGAGCACTATGCAAGATTTTACAAGTCTGGAGACTTGGCCTACTATAATGCCGATTCC
ACCATGGAGTTTGTTGCACGCAAAGATACCCAGGTAAAGGTTCGTGGATTCCGGGTCGAATTGGGCGAAGTTGAG
CACCATGTACGACTAGGCTTGCCCGAAGCGCGGCAGGTGGTTGTTGATGTGCTTGCCGCCAGCGAAAGCGATGCT
ACTGCAAAACTAGTGGCCTATTTGTGTTTCTCGTCGGCAACGTCGAGTCCCGATGATGAGGGCGAGAACAACAAG
AACATGATGATGGCGCTTGATGAAGCGCTCTCGAAAAAACTATTGGAGCTCAAGGCCTATCTCGAGGTGCGGCTG
CCGCAGTATATGGTGCCCGCCGTCTTTATCCCTATTAGGCATGTGCCCTTTATCACGTCGCACAAGATTAATCGC
AATTTGCTTCGCACGGTGACGCGAGAGCTTTGCGCTCAGGAATTGGCGCCATATATGCTTTCCAATACGGAAAAG
GAGGCCCCTGCAACGGAGCACGAGGTGGCGATGCAAAAGCTATGGGCAGAAGTGCTTCACGTACCAGTTGAGCTT
ATTGGTCGGCACGATAGCTTCCTTCAGCTTGGTGGCGATTCCCTCTCGGCGATGCGTCTAGTATCAAAGGCGTAT
GAAGCGGGAATCCAGCTAAGTGTTGGGTCCATCTTCAAGGACGCTCGACTTGCTCAAGTGGCAGCGGCTGCGTGT
TTTGACGACTCGAGGCGTCATGTTGTACCCGAGCCCTGGGAACTAATTGAGGATAGCAAACGTGACAGGATGGAA
CAAGTAGTCAGACAGCAATGCGGCTTGTCCGACAGCGACATTATCTCAGATGTTTACCCGGCGACTGCGCTCCAG
GAAGGGCTGATTGCCTTGGCGAGCAAGCAGCCCGGATCCTACATGGCTGGCTTTACCTTTGAGCTGACTACTGGG
ACGTCGGTGCAGCGCTTCAAGGATGCATGGGAAAAGACGCTAGCAAGATGTCCTGCGCTGCGCACGCGAATTGTG
CTGTGCAGCGACGAAACGATTCAGGCGGTGCTTGAGCGTCCAGCTAGCTGGGGAAAAGAGGGCGAGACTATGATG
ATTATGGGATACGGAACGCCTCTGTGCGCTTACTCGCTGACCAAGAAAGGCGATGAGAGCCTCTTTAGCCTCACG
ATGCACCACGCCATTTTTGATGGATGGAGTCTGGGCGTCATTATGCGCATCTTGTCGCAAGAGTATGATGGACAA
ACAGCCTCACTCTCCCCTCTGACTCCCTATGTCAGCTTCGTCAAGTACACACTCGCCCTTGACGAGGAAAAGGCA
GCAGAGTATTGGCGCGGACAACTGGCGCAATCGCTACGGCCCGAGTTCCCGCCAAGAGATACTCGGCCGGCTGCT
TCAACATCTGCACAGGCTCATGACAGCCACGTGGTGAGGCATCATTTTGCCTTTGATATGAAGAGCCAAAGGCTG
GTGACCAAGGCCACGGTGTTGCGGGCGGCGTGGGCCGTGGTTATGGCGCGGTACAATAACGCCGATAACATCACC
TTTGGCGCAGCAGTAGCTGGACGGCAGGCATCCGTGGCTGGAATCCAAGACATTGTCGGGCCAGTCTTGTCAACG
GTGCCTGTGTGCGTTGGCGTGTCGGCTGGACAGACGGTCAAGGATTTCCTGTTGGCGGTACAGGCGCAGGCTGTG
GGCATGATTGCCTTTGAGCACATGGGCCTGCAAAACATTGGTCGCCTGGGACCCGAAGCTCGCGATGCCTGCGAC
TTTTCGTCCATGTTTTCCGTTCTTTATAGTTCTATTGTGTCGGATGTGCAGACGAGCATCCTCAAGGCGAGCCCG
AGCAGCAATGCCTCGACCGACTTTGGCACTTACTTTACCTATCCGCTCGTGGCCCAGTGCTTCTTGTCGGAGCAA
GAGGCCATTCTCGAGCTCGTGTATAACTCGTCGTCGTTGTCGCGGGCGCAGGTTGAGGCCATTGCCGCACAGTAT
AGCCATGTGGTTGAGCAGCTCTTGTCGATGCAGTCGGCCGACGACGAGACGGTCCTGGCAGACGTGACGCTGTGT
GGCGAATGGGACATGTCGCGCATCAAGCAGTGGCATGATGCTCTGCCGCCCATTCGGCCTGTCGAAGCATGCATC
CACCACCTCATTTCAGCCACAGCTGCCGAGACGCCTGAAAAACAGGCCCTTTATGCGAGCAAAGAAAGCTTCACC
TATGCTGAGTTTGACGATTTGACAAGCAAGCTGGCTTGGCACCTCGGCAGGCTGGGCGTTGGGCGCGGCTCCCTC
GTTCCATTTTCCTTTGAAAAGTCGCCGTGGGCCATTATTGCCATGCTGGGCATCCTCAAGGCTGGCGGCGCCTTT
GTGCCATTGAACCCGAATGATCCCATTGCTCGCCAGAAGACGCTTTTGGCTGACTTGGGTGCCGAGCTTTTGCTT
GCTTCGTCATTGACTGCTGAGAGATACGGCGAAACTGGCATCTCTGTCGTTGTGGTGACTTCAAGTCTCTTGTCG
TCACTATCGAGTCAAGCAAGTAGTAGACATGACGAGCGCAGCATAGTCGGGCCACATGACATTGCCTATGTGCTA
TTTACCTCTGGAAGCACTGGAACGCCAAAAGGAGTCGTGGTTGAACATTGGTCCCTCTCTTCGATTGTGTCGCGC
CGCCCAGACTTAGTCACCTTCGGGGCGGATTCTCGCGTCTTGCAATTCTCGAAATTTGTCTTTGACGTTAGCTTG
GAGGAAATCTTTGCGACGCTCCTCTTTGGAGGCACACTCTGTATCCCATCTGAGGAGCAACGAATTGACGACTTG
GCCAACTTTATAAACGAGGCCAATGTCTCGTGCGCTATGTTGACGCCCTCGGTTGCGCGCCTCATGACGCCGGCA
CAAGTACCACAACTCAAGACGCTGCTGGTGGCTGGAGAGCCTCCGTCCATGGACCTTGTTGAGACATGGTCGCGC
AGTGTCGAGTTGTGCAATGACTATGGGCCGGCCGAAGCCTGTGTCTACGTGGCTTCGCATCTGATGCGGCCCACG
GCACAGTCGGCCTCGACAATTGGTCGTGGCTGCAACTCTCGGCTTTGGATTGTTGATGCCGAGAACCATGACCGT
TTGGCGCCTGTTGGGTGCATTGGCGAGTTGATGATTGAGAGTCCAGGCGTTGCTCGTCATTACCTAAACGATGCG
ACCAAGACGGAACAAGCATTTTTCCAGGGCACCTCGTGGCTCCCGCGAGATGGCCAGAGACACAGAATTTACAAG
ACTGGAGATCTCGTGCGCTACAACCTTGACGGAACCACTGAAGGTGACGGCACCATTGAATACATTGGCCGCAAG
GATGGCCAGACCAAGATTCGTGGGCAGAGACTGGAGATTGGCGAGATTGAGTACCACATCAACCACCAGCTTGGG
CCACAGTCGACCTCATCAGTGCAGCTGGTTCAGGTCGAGGGCAACGCTGCCTTGTTTGCCTTTGTCTCGACCCAA
GGAAAAACAGGCACTGACGAGACCGAGGCCATTGCGCCGCTGGACAAGAGCACATTGCACTTGCTACGGAATCTG
CATCAAGGCCTGCAATCAATCTTGCCCTCGTACATGCTTCCTTCCTACTATCTGCCCATTGCCTACTTGCCTCTG
TCTGCTTCGGGCAAGACAAATGGTCGAGCGCTGCGGCAGTGGGTCAAGCACTTGTCTGCCGAGCAGCTTGCCGAC
TATTCGCTGATGCAGCAGGTCGAGTTTGAGTCACCCGTCACTGACATGGAAATTGCGCTTCAGAGGCTGTGGGGG
AGTGTTTTGAAGTACCCCGCGGAAAAGATTGGCTTGAATGACAGCTTCCTTGAGCTCGGGGGCGATTCTATTCGT
GCCATTCGTCTCATTGCTGCTGCGCGTGAAGAGGGTATTATGCTGACCGTGTCAGCCATATTTCGCGATGCTCGT
TTGCGAATGGTGGCTGCAGCCGCAACTACTGGCCAACGGGATACCGTGGACGAGGGCAATGCAGAGCCATTGAGT
CTATTACCACCACACGACCTTGTCGACATTACCAATACAGTCCGTCAGCAGTGTTCGCTATCGGCAAATGATGTA
ATTCAAGACATTTATCCAGCAACCCCACTCCAGGAAGGTTTGATGGCGTTGGCTACCAAGAAGCCGGGTTCATAT
ACGGCTCGATTTGTCTACCAGCTGGCGCCACACGTCGACGTTGATCGCTTTACTATTGCGTGGCAGCACGTTGTG
CGCCTATGCAGCACGCTACGCACCAGAATTGTAATGTGTGGTGAGCGGACGGTGCAAGCTGTTGTGCAGGAGCCA
GCACATGCTTCTAACCTGGACAAGGTGGAATATGGAAGCCCCCTGTGTCACTGCTCTATTGAGAGTCGTGGAGAT
GAGACACTGTTTAAACTAGTCATGCACCATGCTATTTTTGACGCATGGTCACTGGGCCTCATTCTCCAGCTCCTA
ATCAAGGCGTACCACGATCCTCAATCCGTGCTGCCACCGCCTCCCTACGCCAACTTTGTGCGGTATACCCTCAGC
CTAGACTTGCCGCAAGCATCCGAATACTGGCGCAAGAAACTCGAAGGCGCATTAAGGCCAGTCTTTCCGCGACGA
TCAGGACCCTTGGTACAAGCGAGCGGCGGCGATGCACCGAGCTGTTCAAGCAAAGTGCTGCTTCATCGTGTGCCT
TTTGAAATAGACGGCCAGCTGCCCGTTACCAAGGCGACCGTCTTGCAAGCTGCATGGGCCATTGTGCTTGCCCAG
TATAATGATGACGCCGAGGATATCGTCTTTGGAGCCGTGGTTGCAGGCCGACAGGCTCCGGTAGCAGGTATTGAG
ACAATGATTGGCCCCGTGCTATCGACGGTGCCTATTCGAGTCTCTTTGCCACGACGGCAGCCTGTACAAGACGTG
TTGCTTTCAATCCATGCCCAGGCGAATGAAATGGTACCCTTTGAGCACTTGGGAATTCAAAACATTTCAAAGTTG
AGCAAGGATGCGCAAGACGCGTGCGATTTTTCGTCTCTATTTACAATTCAGTATGGCGCTGCCGACTCGCAGTCC
GAGACACCCTTTTTGATACCAGTCTTTGATGCGGACCGGTCGACCGATTTCAACACTTATTTTACCTATCCACTC
GTGGGCCAGTGTTGTCTATTGGATCGAGAAGCTCAACTGCAGCTTGTATACGACTCGTCGGTCCTGTCAGAGCCT
CAAGTTGCTCGCCTAGCTGCGCAGTACGAACGCACCGTTCAGCAGCTTCTTTCTATTCAACATGAGGGTCCAGGG
CAGTGTCTCACGCTTGACAAGGTCAATATATGCACCGATTGGGATAAGCAGGCGATTGAGCAATGGAATAGCAGC
GACCCAGAGTTGATGGCTGTCAATGAATGCGTGCATGAGCTTATTGCAAAACGTGCAGCGCAAATGGGCGATGAA
GAAGCAATCTTCTCTTCTGACGGTTGCTGCACTTACAAGGAGCTGGACAAGATGACGACACTTGTCGGCAATTAC
TTGCAGAGCCAGGGCGTTGGCATCGAATCGCTTGTTCCGATTTGCTTTGAAAAGTCCATGTGGACGATTGTGGCA
ATGATTGCTGTTATGAAGGCTGGCGGCGGCTTTGTGCCCCTAAACCCAGACCACCCTATTCAGCGACGTCAACAG
CTAGTCACCGCTCTCAAGGCCCCGCTAATGCTTGTTTCGCCAAGCACGTTTGACATTTGCCAAGAGATGGATGTC
CCTCTAGTCACGATTTCAGCAGACTTTGTTGCCTCGTTGCCGGAAAGCGTCCACTCGCATGATGCTGTGCCGAGC
AATATAGCATATGTTCTTTTTACCTCGGGCAGCACAGGTGCACCCAAGGGCGTGGTGATTGAGCACCGTGCCATT
GCATCTAGTATATTTGGACATGGTGTCGCCATGGGCATTGAGTCTGGTACCAGAGTTTTGCAATTCTCCAACTAT
ATCTTTGATGGCTCGATTACGGAGTGCCTTGCAACGCTTGTTCTCGGAGGAACAGTCTGCGTCCCTTCTGATGGG
GAACGCCTCGATGGCTTACAGAATTTCCTGGTCAATGCCAGGGTAGACTGGGCCATGCTGACGCCGTCTTTTGTA
CGAACGCTCAACAGAGAGCAGGCGCTTAAAACTCTCAAGACGCTTGTGCTGGGAGGCGAGGCGGTGCCACAAGAT
GTAGTCGATGCATGGGCTGGTCGGGTCAATCTCATCAATGCCTATGGCCCGGCAGAAGCATCAGTGTGTATTGCG
ACGCACACTGTACAAAATTCGACACAGCAACAGTCTCCGCGAACCATTGGGCGCGGGCGCAATAGCCGTCTGTGG
ATTGTTGACGCTCAGAACCACGACCGGCTTGCCGCTGTGTATTGCATTGGAGAGTTGGTTGTGCAAGGACCTAGT
CTTGCGAGGGGCTATCTTAATGACGAGAAGAGGACGCAGCAAGCATTTATACAAGCAACATCGTGGTTGCCATTT
GGCGAGCACCAGCGACTCTACAAGACTGGCGACTTGGCCCGGTATAACAGCGACGGCACCATTGAGTACATGGGG
CGCAAGGACAGCCAAGTCAAGCTACGGGGCCAGCGGCTCGAGCCAGGCGAAGTCGAGTTTCATATCAAGCAAATC
CTGGGCTCACAGTTTGGCTGCTCTGTTCAAATCGCGCGGGATGCACTCTTTGCTTTTATTTGCACAGCAGGGCCA
GTGCAACAGACTGGCAAGGCAACCAGTCCTGGCAGCGAGGGAAACTGCATCTTGGGTGTGGACAAGGAGGTGCGG
CAGCTGTTTAACAAGCTTCAAGAGAGTCTTCGATTGGCATTGCCTGCCTTTATGGTACCATCATACTACCTCTCA
GTCTCACAGTTGCCATTAACAGCCTCTGGAAAGATTGATGGCAACGCCTTGCAAGCATGGGCTCTTGGCTTGTCG
ACAGAAGACTTGGTGCAGTCATCTCCATCAGTTCAAGTCGAATTTGAGCCTCCAGAGACGGAAATGGAGGGCGAG
CTACAAAAGCTATGGAGCCAAGTCCTGGGAGTATCACCAGACAAGATTGGCCGCAGCAATAGCTTTCTTCAACTT
GGAGGCGACTCCATTACTGCGATTCGCCTAGTAGCAGCAGCTCGCGAGAAACACATTAGTCTGAGCGTTTCCTCC
ATTTTTCAAGACGCGCGGCTCAAACAAGTGGCAGCATTGGCGGAATTCCAAGATTTATCCAAGAATGACGAGGCC
ACGCTGGAGCCGTTTGCCTTGGTTTTATTGGATAAGTGTGAGGAGCTTTGTCAAGCGGTTCGTGAGCAGTGCGCA
CTCGCTGCAGACGAAACAGTCCAAGACGTCTTTCCGACGATTCCTTTGCAAGAGGGTCTCATGGCGCTTGCGGTG
AAGCAGCCTGGATCTTATATGGCTCGCTTCGTGTTTGAGCTGGCTGATCAAGTTGATGTTGGTCGCTTCAAGGCG
GCTTGGGAGGCGACTCTGACAAGGTGCGCGGCACTAAGGACGAGAATTATTATCCACAATGGCCAAACTCTTCAG
GCTATTATTCAACAAGCACCAGACTGGAAAGATGCAAACTCGGCGCAGCTGAGAATGGCGTATGGAACGCCGCTA
TGCCGCTACTATTTGGCAAGCCGCGGCAGCAAGAAGCAATTTGTCCTAACGATGCACCATGCTATATTCGATGGC
TGGTCCTTTGGAATCATTATGCGGACGCTTTTGCAAGCCTATCAAGGGATTATCTTTTCAACACCATTGACTCCC
TATGCTGGCTTTGTAAAGTACGTTGTCGAGTTGGATGTGGAGCGCGCTGCAGAGTTTTGGAATGAGCAGCTGGAT
GGAGCCTTGCAGCCCGTCTTTCCTCGTCGAGCCGCAGCATCATCGCGTCTAGTAGACGCTGCTACAGCAAGTCGG
ACTCTGGTGCACCAGGTGCCCTTTGAGGCGCCGCCTGCAATGTCAGTGACCAAGGCAACCGTGCTTCGAGCAGCA
TGGGCCATTACTCTTGCGCGCTACAACGATGGCACCGATGACATTACGTTTGGAGCTGCCGTGGCTGGTCGTCAG
GCCCCCGTGTCTGGCATTGAAGGCATGGTTGGGCCAGTCATTTCGACGCTGCCAGTCCGTGTAAAGTTGAATTCG
CAACAGCGAGTCGGCGAGTTTCTTGGAGACTTGCAGTCGCAAGCCACAGACATGATGCCCTTTGAGCACATGGGT
CTACAAAATATTGCAAAGCTTGGGTCTAGTGCGCGCGAGGCATGCGATTTTTCCTCGCTCTTGGTCATTCAACCA
CAAGCAATTACGGGTGATGTGGAAAGTGGTTTTCTAAAACTACGTCGCACCGATGCGGATGACGATCAGTATTTT
AGCTACCCGCTTGTTTGGCAGTGCTATCTGGCGGGCGACCAAGTCCACTTGCACGTTACATATGACTCGTCTGTG
CTGGGCGAGAAGCAAGCGTCGTTGATGGCTAATCAGTTTTGCCACGTTGTCGAGCAGCTCCTGGCACCAGACGTG
CACCTTGAGACCAGCAGCGTCGTGGTCGGTGATGTGACTCTCTGCGGGCCTCGGGACTTGGCCATTGTTACGGAG
TGGAACAAGAAGCGCCAGGCCGAGATTGTCTCTTCGACTTTGCACGAGTTGGTGGCGAAGCAGGCGAGGATGCGT
CCGTCTTGTCCAGCCATTTATGCGTGGGACGGCCAGCTGAGCTACCAAGAGCTGGATACCATCTCGACACGATGG
GCTACCTATCTCTCCTACAAGTATCATGTCAAATCCGAGGAGCTGGTGCCGCTGTGTTTTGAAAAGTCACTCTGG
TTCTACGTTGCCATGCTTGCTGTCAATAAGGCTGGTGGTGCTTGGCTGCCTCTAGACCCCTCACACCCTACACAT
CGGCACCAGGTGGTTGTCAAGCAAGCCAAGGCCCGCATAATTTTAACGTCGCCAACGGCAGTGGAAAAGGCCCGG
GGCCTGGCGCGGCATGTGGAGGTGCTTTCCCCCGAGGCTGACAAGGCTGTCACAGAGACGCTACGCGACAATGGC
ATTGCCCTGTCGGTCAAGGCTGTGCAGCCAAGCAACATTGCCTATGTGCTATTTACGTCTGGAACAACGGGCACG
CCCAAGGGAATGGTTATGGAACACGGAGCCTTGTGTTCAAGCATGACTGCTTCGAGTAAAAGACTGGGAATCGAC
CCAGACAATGTGCGCCAACTACAGTTTGCGGCCTATGTGTTTGATTTGGCCATTGGCGAAATCATACCTGCGCTC
ATCTCGGGCGCTTGCATTTGTGTGCCATCTGAGCACCAGCGCCTCAATGACTTGTCGAGCTTTGTGGCTGAGTCG
AGGGCAAATTGGGCCTATCTGACGCCTTCATTTAGTCGCATCCTGTCTCCGACAGACGTGCCCGGTCTTGAAGTC
CTCATGTTTGCGGGTGAGGCAGTTGGCACGGACCACTTGGCCAAGTGGTTTGGCCGTCTTCGTCTCATCAATGCA
TGGGGTCCATCAGAGGCGTGTTGTTTTGCATCATTCCGCGAGTACGAGACGGTGGACGACTCGCCTCTAAACATT
GGATTTCCAGTGGGAGCGCGAAGCTGGATTGTTGAACCAGACGACTACCACCGTCTGGTGCCAATTGGCTGTGTT
GGAGAGATTATGCTGCAGGGGCCGACTCTAGCCCGGGAATACCTGGCTTTTGAAGCGGGCACCAAGGCTAGCTTC
ATTACAGACTTGCCCGAGTGGGCGCCAGACAGGGAGCAAGTGCCGTACTCGCGGTTTTACAAGTCGGGCGATCTC
GGATACTATAACGCTGATGGAACCATGGAATTTGTGGCGCGCAAGGACACTCAAGTAAAGATTCGCGGCTTCCGC
ATCGAGTTGGGAGAGGTTGAAAGTCAGGTTCGCAATGCGGTTGGCGGCATTCAACAGGTGACTGTCGATGTTCTA
AAGTCGCAAGGAGTTGATCGGCTCGTGGCCTATCTATGCTATTCCTCGGCGATGCGAACACCTGAGAGTGGCAAT
TCAGACTTTTCAGACTTGCTGCTCCCCATGGACGAAACAATGACACAAGAGGCCGCTAGTCTCAAGAGTTTTCTC
CAAGTAAGACTTCCCTTGTACATGGTGCCAACAGTTTATATCCCTGTGCGGTATATGCCCTTTATTACATCGCAA
AAGACGGATCGCAGGATACTGCGACAGACGGCGAGTTCCATTTCCAATGCAGAACTGGAACAGTACATGTTGGCA
AATGCCACCAAGGAGCCGCCAGCCACAGCCATGGAGACGCTTTTGCAGAGTCTCTGGGCCGACGTCTTGTCTATT
CCGACGGAGCGAATTGGCCGCAACGACAGCTTTTTGCATCTAGGCGGCGACTCACTTGGCGCAATTCGCCTCATT
ACCAAGGCCCGACAACATGGCGTGCAACTGAGCGTGGCAAACATTTTCAAGGATGCTCGCTTGAGTCAAGTGGCG
CTGGCTGCGCAAACGAGCATACAGGACGACGACATGTCTGTCGCTCCCTGGAGTCTGGTGCCGGCAGGGCAGAAA
GAGGCTCTTGTTGGCGCTGCTGAGGAACAGTGTCGGGTGCATGAGCAAGGTTTGACGATTCAAGACATTTATCCC
ACGACGCCGCTGCAAGAGGGTCTCATGGCATTGGCTGTGAAGCAAGCCGGATCCTACACAGCCAAGCTCAGCTTG
GAGCTTGCCGGTGCCGACGTTGGCCGCTTCAAAGCAGCCTGGGAATACACTCTTGGTGTGTGTGCGGCTCTCCGA
ACGCGAATCTTTAGACATGGGCCAGACACAATGCAGGCCGTTCTCACAGGCCCGGCACAGTGGCAATCGTCGGCC
ATTGAGGCATGCAACATGGTGTACGGATCCGCACTCTGCCAATATGCTCTGTTTAGTCGAGGCGACGACACCGTC
TTCTCCTTGGCTATGCATCATGCTATTTTTGATGGATGGAGCTTATCAATTATTATGAAGACGCTGACGCAGGCC
TATGAGGCTTCCGGCAATTTTGCTGCTCTTGAGCCTCTTCCGCCCTACTCGCTCTTTATCCGCCATGTACGCAGC
CTGGACCAGGTGCGAGCAGCCGAGTATTGGCGTGGACAGCTTCAAGGGGCCCTGTCTCCAGTATTTCCCCCACGG
CCAACCTCGACATGTCCGCCCTTGTCGAGTAAAACAGTGACGCAGCGCATTGCGCTCAAGAGTGCGTCTCAGCTT
GCAGTAACAAAGGCTACCATTCTCCGCGCTGCCTGGGCCATTGTTCTCGCCAAGCATAATGCCAATGCACAAGAC
ATTACGTTTGGGGCGGCAGTGGCGGGCCGCCAGGCGCCAGTCTATGGCATTGAGAGCATCGTGGGACCAGTCATT
TCCACGGTGCCAATCCGCGTCAAGCTGGATGAGGGGCAGTCTGCACAAGACTTTTTGAAGGCGATGCAAAGCCAA
GCGGTTGAAATGATGCCCTATGAGCACATGGGTATTCAGAATATTGCCCAACTTGGTGCTGATGCGCGTCAAGCC
TGCGACTTTACCTCTTTGTTTGCCGTTCAGCACCGCACTATTTTGTCGGGCGCACAAGCCTCCTTTTTGACCCAG
TCTGGCAAGGACGGGGACAAGCAGCAGACGTCTAGCTATGCGACTTACTTTACCTATCCGCTCGTGGGACAGTGC
TACCTGTTTGACGATGAAGCTGCGCTTGAGCTCATTTACGATGGCTCCGCGCTCTCGGATGGACAGGCTGAGGCG
TTTGCCGCTCAATACGAGCACATTGTGCAACAGCTCTTGTCTGTACAAGTATCTGGACACGACGACTTGTGTGTT
GGACAGCTAAGGCTGTGTGGCAGCTGGGACGTGGAAAAGATTGAGCAGTGGCACGCGCAGGAGCCAGAGTTGACA
TTGGTTGAGTCGAGGATCCAAGACTTGATTGGCCAGACTGCCTCGTCTTGTCCCGACAAGGAGGCCATTTTGTCG
TGGGATGGGAGGTGTACATATGCTCAACTAGAGCACATGACTTGCTTGCTGGCCCAGTATCTGGGTGCAAAGGGG
GTGACGAAGGGATCGCGCGTGCCGATTTGTTTTGAAAAGTCCATGTGGACCATTGTGGCCATGATGGGCATATTA
AAAGCGGGAGGGGCGTTTGTGCCGCTGAGTCCAGATCATCCGGCGAGTCGAAGGCGAGAGTTGGTGCGTGATTTG
GGGGCAAAAGTTGTCGTTGTTTCCGAGGCGACGCAAAAGGCGTGTAGTGATTTGGGGGTGAGGGTGGTTGTGCTG
TCGGCGGGGTTGATGGGTGAGCTTTCGAATTCTGACGACCATGAGCAAGTCGAGGCTATGAATGGAGACGACGAA
GTGACGCCTGGTGGAGGCGCGGCATATGTGCTCTTTACCTCTGGCAGCACGGGCAAGCCCAAGGGCGTCATTGTC
GACCACTATGCCATTGCATCGAGCATCAAGGGCCACGGCACTGCCATGGGCCTGGGACCCGAGTCACGAGTCTTG
CAGTTTTCCAACTACATCTTTGACGGATCCATTACCGAATGCCTCGCAACCTTGGTGTTTGGCGGTTGTGTGTGC
GTGCCTGGTGACGAAGAGCGACTCGGAGGATCTCTGAGCGATTTTATCCAGGCTTCACGCGTCAACTGGGCCATG
CTTACCCCGTCGTTTGTGCGGACTCTAGACCAAGGCCATGTGCCCACGCTCAAGACGCTGGTGCTTGGAGGTGAA
GCACCAACACGAGACGTTATTGAGCCCTGGCTTGGACGGGTGCGTCTGCTGAATGCCTATGGACCAGCAGAGGCG
TCGGTCTGCATTGCCACCCATGTCATTGAATCAGCAGCCTCACCGAGCGCAATTGGACGCGGGTGCAACGCTCGA
CTGTGGATCGTGGATCCCGAGGACCAAGATTGTCTGGCTGGTGTGGGATGTGTTGGCGAGTTGGTGGTGCAAGGG
CCAGGGCTTGCTCGAGGCTATCTCAACAATGAAGCAGCAACGGCGCGTGCCTTTATCAAGGCTCCGGCCTGGCTG
CCTCGAGGTGCGTATGAGCGCGTCTACAAGACTGGCGATCTTGTGCGGTACAGCGACGACGGCACGATTGAATAT
GTTGGTCGCAAAGACACGCAAATCAAGATTCGCGGCCAGCGGTTAGAGTCGGGCGAGATTGAACACCACATGCGC
GATCTGCTCCACGTGGCGCGCCAGGTTGTCGTGACAAAGGCCCAGATTGCTGAGCAGGATGTCCTGGTGGCCTTT
ATTTGCACGACGAATGGCCAGACGCAGTCGTTGGACTGTGGCCTTGCCGAAATGGATGACGGGCTTGTCCGGGCG
TTTGTCGCCTTGTCGCAAGATTTGGCCACGCGCGTGCCGGCATACATGGTTCCCTCGTACTTTATTCCCGTGCGG
GCCATGCCCGTGACGCCAACCGGGAAACTCAACACTAGGCTTCTTCAAGATGAGCTTCTCGGCATGAGTGTGGAT
GAGCTGCGGCAGTATGCAGCGTGCCAGAGGGCTCCCTTTGAGGAGCCGCGCAACGAGACGGAATCTCGATTGCGG
GGCCTATTCTCTCAGGTTTTGAATATCTCGGAATCGCAAATCAGTATAAACGATGGGTTTAGCCAGCTTGGTGGC
GATTCACTCAAAGTCGTGACATTGCAGGGCCAGATTCGGCGGTGCTTTGACAAGATGTTGAGTATTCAGCTGCTC
AACCGCCGGGCCATGTCTATTCGCATGTTGGCTCCCTTGGTACTGGGCGAGACGACGGATGCTGGTGCCGCCGAG
GAAGATTTTGGAAAAGTACTCACAACCATGTTGGATCAAATCTGGCCCATGGGCAACAAGATTCGGCAAGACTAC
GTTTCGGTTGATTTTGTACCGCAAGCTCACGTCTTTCTTACGGGCGCAACGGGATATCTCGGCACGGCTCTCCTC
CATCGCTTAGTGACGGAGTCGAGCATTGAGAAAGTGACTGTGCTTGTGCGAGCAAAGACGCGGGCCCAGGCTCTA
GAGAGGGTCAAACGGTCGGCTCGACTTGGCGGCTGGTGGCACGAGGAATTCATGGCCAAGCTGCAAGTGTGGAAG
GGAGACTTGGGCATGCGTGGCTTTGGCCTGTCGCAAGATGAGTGGAGGGTGCTGACGAGTGGAGTGCATGCCATT
GTGCATAATGGTGCGGCGGTGGATTGGAGTGCTGATTTTGCGTCTCTCAAGGCGGTTAATGTGGACTCGACGCGG
CAACTTGTTGAGATTGCACTGGCGTCGCCGGCGCATCCCAGAATCTTGGCTACAGCCAGACAAAGGTGCTCTCTG
AGCTTCTTGTTGGCGAGTGTGCCGCCCGACTACCTGCGCACCAAGACCAGCTCTCAGTCGTCAAGCCAGGACGCA
TAA
Gene >OphauB2|5225
ATGGCGCGTGGTAGCGACAACGACCCTGTGCGCGCGCTCGACGCCGAGACAATCAAGAAGCTCCAAAATGTCGAC
CAAGATTTGCGCCTAGCCCTGCCAGACTTCATGGTTCCATCCTACTACCTTCCCATCCACAAGTTTCCCCTCACA
ACCTCTGGCAAGGCAGATACGCGAAAACTGCAAGAATGGATACTCCATCTCGCCAAGCAGCAGCAGCTGGCTCCA
TACTCGCTGGCCACGCGAGCAGAGTTTCAGCGGCCCACGACGGCCATGCAATTGCGGTTGCAGAAGCTGTGGGCA
GACATCTTGGGCCTCGAGGCCGACTCGATTGGACGCGACGATAGCTTTCTTCGGCTTGGAGGAGACTCAATTGCT
GCGATTCGCCTTGTTTCTGCGGCGCGTGAAGAGGGAATACACATCACCGTGGCGTCCATTTTTCGCGACCCGCGT
CTAAGCCAGGTGGCGGCGTCTGCCATTTTGCAAGACGTCGAGGGTCAAGAGAGCAGCGTGGCACCGTGGTCATTG
GTGCCCGAGGCTCAGCAAGAGACCATGGCTGCAACAATTCGCAATCAGTGTCGTCTTGGTGCAAGCGACGAGATT
CAAGATGCGTATCCGGCTACAGCATTGCAGCAGGGCCTCATGTCACTTGCCGTCAAGCAGCCGGGGTCGTATATT
GCTCGCATGACGTTCCAGCTGCCCTCTGACATTGACGAGCATCGCTTCCGAGAGGCGTGGCAAGAGACGCTTCGA
CTGTGTCCCATTTTGCGAACCCGCATCGTCGCACAGGCAAATCAGGCCATCCAGGCAGTCATTAGCCAGCCAGCA
GAATGGGACGCGGGCGAGCTAACTAACGTCACCATGGAGCACGGCACGCGTCTCTGTCGCTATGCGCTGGTGGAT
GGCGGAGAGGGAAAGCTATTTATGCTGGCCCTCCATCACGCAATCTTTGACGGCTGGAGTTTGCCGCTAATTATG
CGAACACTGCTAGGCGCCTACCAGCACGAAACAGCGCCTGCCCTGGTTTCATATGCCAGATTCGTCAGGTACGCC
TTGGACATTGACTCGGTCAGGGCGGCTGCGTACTGGAAGGCGCAGCTGGAGAACGCTGCCCGGCCGTCCTTTCCT
CGCCGTCCCGACGCGACAGCAGGGCCAAGACGTGCTTCGAGTCAATCGCTGGCGCGCCATTTGCCCTTTGACACG
ACTGACGAGCTGCCCGTCACAAAGGCCACGGTCCTGCGAGCGGCATGGGCCATTCTCATGGCAAAGTACAATGAC
GACGCGTCCGATATTACCTTTGGCGCCACAGTCGCCGGTCGGCAGGCCGCCGTGACGGGAATCGAGGAGATTGCT
GGTCCCGTCATTGCCACTGTTCCCATTCGCATCAAGCTGGATGCGAGACAGCCCGTTGCCGAATTTTTGCATGGT
GTGCAAACCCAGGGCGCTGAAATGATGCCCTTTGAGCAGTTTGGCATGCAGAATATTTCGAGACTGGGCCCCGAC
GCAAAAAATGCCTGCGATTTTTCCTCCTTGCTAGTCATTCAGCCATTCAAGATTCTCAAGGACACGACAAACCCC
TTGTTGCAGTTTTATACTGTCGACAAGGACGACGACGATGCGGCTTCATCAGCCCTGACTGGATACTTTACCTAC
CCCCTCGTCTGGCAGTGCTGCGTCACGGATACTGAAACGGCTCTCTACGTCACCTTTGACTCGTCAGTCTTGTCG
AGGGAGCAGATTGAGACGATGATTGAGCAATTTTGTCACATTGTGCAGCAGCTCATTGCCCCCGACGCGTATAGT
CTGCAAGAGGTTACAGTGGCGGATATTTGTGTTAGCGGCACACACGACATTGCGCTGGCGCGAGACTGGAATAGT
AAAGTGTGCACCGAAATCATCTCGTCAACCTTTCATGACTTGGTGCAAGAACAGGCTCGCATTCGCCCAAATGCA
CCCGCCATTTTTGCCTGGGATGGGGAGCTGTCGTATCGCCAACTAGATGTATATTCGAACCGGCTGGCCAAGATG
CTGGTCAAGAGGCATTCGATTTGCCTGGGCGACTTGGTGCTTGTTTGCTTTGAAAAATCAGTCTTTTTTTACATT
GTCGTTTTGGCAATTAATAAAGCTGGAGGTGCGTGGGTGCCGCTGGATCCATCTCATCCCCAAACGCGACACCAA
AAGGTTACCATGCAATCTGAGGCTCGAATTGCCTTGGTTTCGCCAAAACAAGCAGACAAGTGCCGAGGATTAGTT
GCAGAAGTCATTACCGTGCCGACTGAGCTGGACCCAATGAGTCTGGATGAAGATGACGGGCCGCCGGCAGTGCAA
GTCGGACCCCAGGACGCAGCATATGTTCTCTTTACATCTGGGACAACGGGAACGCCAAAGGGAATCGTCATGGAG
CATGGCTCGCTCTGCACAAGCCAAGTCGCGAGCAGCCGGCAGCTGGGGCTAGAAGCAGAACAAGTGCGGATTTTG
CAGTTTGCAGCCTATGTATTTGACCTTTGCATCGGAGAAATTATTGGGCCTCTTATTTCTGGCGGGTGCCTGTGT
GTTCCGTCTGAATACCAAAGGATGAATGATATCGTCGGCTTCATCAACAAGGCACGCGTGAATTGGGCATATCTA
ACGCCCTCGTTTGCTCGTTTTCTCGTGCCAGATTCCGTCCCGAGTCTGCAGCTGCTTCTTTTGGCTGGTGAGCCT
GTTGGCAAGGACTTGCTTTCCACGTGGCTGGGACATGGCGTCCGGCTAGTCAATGGCTGGGGCCCGTCCGAGACT
TGCTGCTTTAGCTCACTGCTAGAATGGTCCAGTCCCGAGCAATCGCCCCTCAACATTGGCCGTCCAGTCGGCGGC
CATTGCTGGATCGTGGATCCCAGCGACCACCATCAGCTAGCTCCCATTGGGTGCATTGGCGAAGTTGTCATTCAG
GGACCAACGATTGCGCGCGAGTATCTTGCCTTTGAAGAAGGAACACGGGCCAGCTTTGTCACCGATTTACCAGCT
TGGGCGCCACGGGTAGATGAGCACTATGCAAGATTTTACAAGTCTGGAGACTTGGCCTACTATAATGCCGATTCC
ACCATGGAGTTTGTTGCACGCAAAGATACCCAGGTAAAGGTTCGTGGATTCCGGGTCGAATTGGGCGAAGTTGAG
CACCATGTACGACTAGGCTTGCCCGAAGCGCGGCAGGTGGTTGTTGATGTGCTTGCCGCCAGCGAAAGCGATGCT
ACTGCAAAACTAGTGGCCTATTTGTGTTTCTCGTCGGCAACGTCGAGTCCCGATGATGAGGGCGAGAACAACAAG
AACATGATGATGGCGCTTGATGAAGCGCTCTCGAAAAAACTATTGGAGCTCAAGGCCTATCTCGAGGTGCGGCTG
CCGCAGTATATGGTGCCCGCCGTCTTTATCCCTATTAGGCATGTGCCCTTTATCACGTCGCACAAGATTAATCGC
AATTTGCTTCGCACGGTGACGCGAGAGCTTTGCGCTCAGGAATTGGCGCCATATATGCTTTCCAATACGGAAAAG
GAGGCCCCTGCAACGGAGCACGAGGTGGCGATGCAAAAGCTATGGGCAGAAGTGCTTCACGTACCAGTTGAGCTT
ATTGGTCGGCACGATAGCTTCCTTCAGCTTGGTGGCGATTCCCTCTCGGCGATGCGTCTAGTATCAAAGGCGTAT
GAAGCGGGAATCCAGCTAAGTGTTGGGTCCATCTTCAAGGACGCTCGACTTGCTCAAGTGGCAGCGGCTGCGTGT
TTTGACGACTCGAGGCGTCATGTTGTACCCGAGCCCTGGGAACTAATTGAGGATAGCAAACGTGACAGGATGGAA
CAAGTAGTCAGACAGCAATGCGGCTTGTCCGACAGCGACATTATCTCAGATGTTTACCCGGCGACTGCGCTCCAG
GAAGGGCTGATTGCCTTGGCGAGCAAGCAGCCCGGATCCTACATGGCTGGCTTTACCTTTGAGCTGACTACTGGG
ACGTCGGTGCAGCGCTTCAAGGATGCATGGGAAAAGACGCTAGCAAGATGTCCTGCGCTGCGCACGCGAATTGTG
CTGTGCAGCGACGAAACGATTCAGGCGGTGCTTGAGCGTCCAGCTAGCTGGGGAAAAGAGGGCGAGACTATGATG
ATTATGGGATACGGAACGCCTCTGTGCGCTTACTCGCTGACCAAGAAAGGCGATGAGAGCCTCTTTAGCCTCACG
ATGCACCACGCCATTTTTGATGGATGGAGTCTGGGCGTCATTATGCGCATCTTGTCGCAAGAGTATGATGGACAA
ACAGCCTCACTCTCCCCTCTGACTCCCTATGTCAGCTTCGTCAAGTACACACTCGCCCTTGACGAGGAAAAGGCA
GCAGAGTATTGGCGCGGACAACTGGCGCAATCGCTACGGCCCGAGTTCCCGCCAAGAGATACTCGGCCGGCTGCT
TCAACATCTGCACAGGCTCATGACAGCCACGTGGTGAGGCATCATTTTGCCTTTGATATGAAGAGCCAAAGGCTG
GTGACCAAGGCCACGGTGTTGCGGGCGGCGTGGGCCGTGGTTATGGCGCGGTACAATAACGCCGATAACATCACC
TTTGGCGCAGCAGTAGCTGGACGGCAGGCATCCGTGGCTGGAATCCAAGACATTGTCGGGCCAGTCTTGTCAACG
GTGCCTGTGTGCGTTGGCGTGTCGGCTGGACAGACGGTCAAGGATTTCCTGTTGGCGGTACAGGCGCAGGCTGTG
GGCATGATTGCCTTTGAGCACATGGGCCTGCAAAACATTGGTCGCCTGGGACCCGAAGCTCGCGATGCCTGCGAC
TTTTCGTCCATGTTTTCCGTTCTTTATAGTTCTATTGTGTCGGATGTGCAGACGAGCATCCTCAAGGCGAGCCCG
AGCAGCAATGCCTCGACCGACTTTGGCACTTACTTTACCTATCCGCTCGTGGCCCAGTGCTTCTTGTCGGAGCAA
GAGGCCATTCTCGAGCTCGTGTATAACTCGTCGTCGTTGTCGCGGGCGCAGGTTGAGGCCATTGCCGCACAGTAT
AGCCATGTGGTTGAGCAGCTCTTGTCGATGCAGTCGGCCGACGACGAGACGGTCCTGGCAGACGTGACGCTGTGT
GGCGAATGGGACATGTCGCGCATCAAGCAGTGGCATGATGCTCTGCCGCCCATTCGGCCTGTCGAAGCATGCATC
CACCACCTCATTTCAGCCACAGCTGCCGAGACGCCTGAAAAACAGGCCCTTTATGCGAGCAAAGAAAGCTTCACC
TATGCTGAGTTTGACGATTTGACAAGCAAGCTGGCTTGGCACCTCGGCAGGCTGGGCGTTGGGCGCGGCTCCCTC
GTTCCATTTTCCTTTGAAAAGTCGCCGTGGGCCATTATTGCCATGCTGGGCATCCTCAAGGCTGGCGGCGCCTTT
GTGCCATTGAACCCGAATGATCCCATTGCTCGCCAGAAGACGCTTTTGGCTGACTTGGGTGCCGAGCTTTTGCTT
GCTTCGTCATTGACTGCTGAGAGATACGGCGAAACTGGCATCTCTGTCGTTGTGGTGACTTCAAGTCTCTTGTCG
TCACTATCGAGTCAAGCAAGTAGTAGACATGACGAGCGCAGCATAGTCGGGCCACATGACATTGCCTATGTGCTA
TTTACCTCTGGAAGCACTGGAACGCCAAAAGGAGTCGTGGTTGAACATTGGTCCCTCTCTTCGATTGTGTCGCGC
CGCCCAGACTTAGTCACCTTCGGGGCGGATTCTCGCGTCTTGCAATTCTCGAAATTTGTCTTTGACGTTAGCTTG
GAGGAAATCTTTGCGACGCTCCTCTTTGGAGGCACACTCTGTATCCCATCTGAGGAGCAACGAATTGACGACTTG
GCCAACTTTATAAACGAGGCCAATGTCTCGTGCGCTATGTTGACGCCCTCGGTTGCGCGCCTCATGACGCCGGCA
CAAGTACCACAACTCAAGACGCTGCTGGTGGCTGGAGAGCCTCCGTCCATGGACCTTGTTGAGACATGGTCGCGC
AGTGTCGAGTTGTGCAATGACTATGGGCCGGCCGAAGCCTGTGTCTACGTGGCTTCGCATCTGATGCGGCCCACG
GCACAGTCGGCCTCGACAATTGGTCGTGGCTGCAACTCTCGGCTTTGGATTGTTGATGCCGAGAACCATGACCGT
TTGGCGCCTGTTGGGTGCATTGGCGAGTTGATGATTGAGAGTCCAGGCGTTGCTCGTCATTACCTAAACGATGCG
ACCAAGACGGAACAAGCATTTTTCCAGGGCACCTCGTGGCTCCCGCGAGATGGCCAGAGACACAGAATTTACAAG
ACTGGAGATCTCGTGCGCTACAACCTTGACGGAACCACTGAAGGTGACGGCACCATTGAATACATTGGCCGCAAG
GATGGCCAGACCAAGATTCGTGGGCAGAGACTGGAGATTGGCGAGATTGAGTACCACATCAACCACCAGCTTGGG
CCACAGTCGACCTCATCAGTGCAGCTGGTTCAGGTCGAGGGCAACGCTGCCTTGTTTGCCTTTGTCTCGACCCAA
GGAAAAACAGGCACTGACGAGACCGAGGCCATTGCGCCGCTGGACAAGAGCACATTGCACTTGCTACGGAATCTG
CATCAAGGCCTGCAATCAATCTTGCCCTCGTACATGCTTCCTTCCTACTATCTGCCCATTGCCTACTTGCCTCTG
TCTGCTTCGGGCAAGACAAATGGTCGAGCGCTGCGGCAGTGGGTCAAGCACTTGTCTGCCGAGCAGCTTGCCGAC
TATTCGCTGATGCAGCAGGTCGAGTTTGAGTCACCCGTCACTGACATGGAAATTGCGCTTCAGAGGCTGTGGGGG
AGTGTTTTGAAGTACCCCGCGGAAAAGATTGGCTTGAATGACAGCTTCCTTGAGCTCGGGGGCGATTCTATTCGT
GCCATTCGTCTCATTGCTGCTGCGCGTGAAGAGGGTATTATGCTGACCGTGTCAGCCATATTTCGCGATGCTCGT
TTGCGAATGGTGGCTGCAGCCGCAACTACTGGCCAACGGGATACCGTGGACGAGGGCAATGCAGAGCCATTGAGT
CTATTACCACCACACGACCTTGTCGACATTACCAATACAGTCCGTCAGCAGTGTTCGCTATCGGCAAATGATGTA
ATTCAAGACATTTATCCAGCAACCCCACTCCAGGAAGGTTTGATGGCGTTGGCTACCAAGAAGCCGGGTTCATAT
ACGGCTCGATTTGTCTACCAGCTGGCGCCACACGTCGACGTTGATCGCTTTACTATTGCGTGGCAGCACGTTGTG
CGCCTATGCAGCACGCTACGCACCAGAATTGTAATGTGTGGTGAGCGGACGGTGCAAGCTGTTGTGCAGGAGCCA
GCACATGCTTCTAACCTGGACAAGGTGGAATATGGAAGCCCCCTGTGTCACTGCTCTATTGAGAGTCGTGGAGAT
GAGACACTGTTTAAACTAGTCATGCACCATGCTATTTTTGACGCATGGTCACTGGGCCTCATTCTCCAGCTCCTA
ATCAAGGCGTACCACGATCCTCAATCCGTGCTGCCACCGCCTCCCTACGCCAACTTTGTGCGGTATACCCTCAGC
CTAGACTTGCCGCAAGCATCCGAATACTGGCGCAAGAAACTCGAAGGCGCATTAAGGCCAGTCTTTCCGCGACGA
TCAGGACCCTTGGTACAAGCGAGCGGCGGCGATGCACCGAGCTGTTCAAGCAAAGTGCTGCTTCATCGTGTGCCT
TTTGAAATAGACGGCCAGCTGCCCGTTACCAAGGCGACCGTCTTGCAAGCTGCATGGGCCATTGTGCTTGCCCAG
TATAATGATGACGCCGAGGATATCGTCTTTGGAGCCGTGGTTGCAGGCCGACAGGCTCCGGTAGCAGGTATTGAG
ACAATGATTGGCCCCGTGCTATCGACGGTGCCTATTCGAGTCTCTTTGCCACGACGGCAGCCTGTACAAGACGTG
TTGCTTTCAATCCATGCCCAGGCGAATGAAATGGTACCCTTTGAGCACTTGGGAATTCAAAACATTTCAAAGTTG
AGCAAGGATGCGCAAGACGCGTGCGATTTTTCGTCTCTATTTACAATTCAGTATGGCGCTGCCGACTCGCAGTCC
GAGACACCCTTTTTGATACCAGTCTTTGATGCGGACCGGTCGACCGATTTCAACACTTATTTTACCTATCCACTC
GTGGGCCAGTGTTGTCTATTGGATCGAGAAGCTCAACTGCAGCTTGTATACGACTCGTCGGTCCTGTCAGAGCCT
CAAGTTGCTCGCCTAGCTGCGCAGTACGAACGCACCGTTCAGCAGCTTCTTTCTATTCAACATGAGGGTCCAGGG
CAGTGTCTCACGCTTGACAAGGTCAATATATGCACCGATTGGGATAAGCAGGCGATTGAGCAATGGAATAGCAGC
GACCCAGAGTTGATGGCTGTCAATGAATGCGTGCATGAGCTTATTGCAAAACGTGCAGCGCAAATGGGCGATGAA
GAAGCAATCTTCTCTTCTGACGGTTGCTGCACTTACAAGGAGCTGGACAAGATGACGACACTTGTCGGCAATTAC
TTGCAGAGCCAGGGCGTTGGCATCGAATCGCTTGTTCCGATTTGCTTTGAAAAGTCCATGTGGACGATTGTGGCA
ATGATTGCTGTTATGAAGGCTGGCGGCGGCTTTGTGCCCCTAAACCCAGACCACCCTATTCAGCGACGTCAACAG
CTAGTCACCGCTCTCAAGGCCCCGCTAATGCTTGTTTCGCCAAGCACGTTTGACATTTGCCAAGAGATGGATGTC
CCTCTAGTCACGATTTCAGCAGACTTTGTTGCCTCGTTGCCGGAAAGCGTCCACTCGCATGATGCTGTGCCGAGC
AATATAGCATATGTTCTTTTTACCTCGGGCAGCACAGGTGCACCCAAGGGCGTGGTGATTGAGCACCGTGCCATT
GCATCTAGTATATTTGGACATGGTGTCGCCATGGGCATTGAGTCTGGTACCAGAGTTTTGCAATTCTCCAACTAT
ATCTTTGATGGCTCGATTACGGAGTGCCTTGCAACGCTTGTTCTCGGAGGAACAGTCTGCGTCCCTTCTGATGGG
GAACGCCTCGATGGCTTACAGAATTTCCTGGTCAATGCCAGGGTAGACTGGGCCATGCTGACGCCGTCTTTTGTA
CGAACGCTCAACAGAGAGCAGGCGCTTAAAACTCTCAAGACGCTTGTGCTGGGAGGCGAGGCGGTGCCACAAGAT
GTAGTCGATGCATGGGCTGGTCGGGTCAATCTCATCAATGCCTATGGCCCGGCAGAAGCATCAGTGTGTATTGCG
ACGCACACTGTACAAAATTCGACACAGCAACAGTCTCCGCGAACCATTGGGCGCGGGCGCAATAGCCGTCTGTGG
ATTGTTGACGCTCAGAACCACGACCGGCTTGCCGCTGTGTATTGCATTGGAGAGTTGGTTGTGCAAGGACCTAGT
CTTGCGAGGGGCTATCTTAATGACGAGAAGAGGACGCAGCAAGCATTTATACAAGCAACATCGTGGTTGCCATTT
GGCGAGCACCAGCGACTCTACAAGACTGGCGACTTGGCCCGGTATAACAGCGACGGCACCATTGAGTACATGGGG
CGCAAGGACAGCCAAGTCAAGCTACGGGGCCAGCGGCTCGAGCCAGGCGAAGTCGAGTTTCATATCAAGCAAATC
CTGGGCTCACAGTTTGGCTGCTCTGTTCAAATCGCGCGGGATGCACTCTTTGCTTTTATTTGCACAGCAGGGCCA
GTGCAACAGACTGGCAAGGCAACCAGTCCTGGCAGCGAGGGAAACTGCATCTTGGGTGTGGACAAGGAGGTGCGG
CAGCTGTTTAACAAGCTTCAAGAGAGTCTTCGATTGGCATTGCCTGCCTTTATGGTACCATCATACTACCTCTCA
GTCTCACAGTTGCCATTAACAGCCTCTGGAAAGATTGATGGCAACGCCTTGCAAGCATGGGCTCTTGGCTTGTCG
ACAGAAGACTTGGTGCAGTCATCTCCATCAGTTCAAGTCGAATTTGAGCCTCCAGAGACGGAAATGGAGGGCGAG
CTACAAAAGCTATGGAGCCAAGTCCTGGGAGTATCACCAGACAAGATTGGCCGCAGCAATAGCTTTCTTCAACTT
GGAGGCGACTCCATTACTGCGATTCGCCTAGTAGCAGCAGCTCGCGAGAAACACATTAGTCTGAGCGTTTCCTCC
ATTTTTCAAGACGCGCGGCTCAAACAAGTGGCAGCATTGGCGGAATTCCAAGATTTATCCAAGAATGACGAGGCC
ACGCTGGAGCCGTTTGCCTTGGTTTTATTGGATAAGTGTGAGGAGCTTTGTCAAGCGGTTCGTGAGCAGTGCGCA
CTCGCTGCAGACGAAACAGTCCAAGACGTCTTTCCGACGATTCCTTTGCAAGAGGGTCTCATGGCGCTTGCGGTG
AAGCAGCCTGGATCTTATATGGCTCGCTTCGTGTTTGAGCTGGCTGATCAAGTTGATGTTGGTCGCTTCAAGGCG
GCTTGGGAGGCGACTCTGACAAGGTGCGCGGCACTAAGGACGAGAATTATTATCCACAATGGCCAAACTCTTCAG
GCTATTATTCAACAAGCACCAGACTGGAAAGATGCAAACTCGGCGCAGCTGAGAATGGCGTATGGAACGCCGCTA
TGCCGCTACTATTTGGCAAGCCGCGGCAGCAAGAAGCAATTTGTCCTAACGATGCACCATGCTATATTCGATGGC
TGGTCCTTTGGAATCATTATGCGGACGCTTTTGCAAGCCTATCAAGGGATTATCTTTTCAACACCATTGACTCCC
TATGCTGGCTTTGTAAAGTACGTTGTCGAGTTGGATGTGGAGCGCGCTGCAGAGTTTTGGAATGAGCAGCTGGAT
GGAGCCTTGCAGCCCGTCTTTCCTCGTCGAGCCGCAGCATCATCGCGTCTAGTAGACGCTGCTACAGCAAGTCGG
ACTCTGGTGCACCAGGTGCCCTTTGAGGCGCCGCCTGCAATGTCAGTGACCAAGGCAACCGTGCTTCGAGCAGCA
TGGGCCATTACTCTTGCGCGCTACAACGATGGCACCGATGACATTACGTTTGGAGCTGCCGTGGCTGGTCGTCAG
GCCCCCGTGTCTGGCATTGAAGGCATGGTTGGGCCAGTCATTTCGACGCTGCCAGTCCGTGTAAAGTTGAATTCG
CAACAGCGAGTCGGCGAGTTTCTTGGAGACTTGCAGTCGCAAGCCACAGACATGATGCCCTTTGAGCACATGGGT
CTACAAAATATTGCAAAGCTTGGGTCTAGTGCGCGCGAGGCATGCGATTTTTCCTCGCTCTTGGTCATTCAACCA
CAAGCAATTACGGGTGATGTGGAAAGTGGTTTTCTAAAACTACGTCGCACCGATGCGGATGACGGTAACCATGTC
GCAGTTGACAGTGACAAAGGGCAGAAATCTGCGGCAGATCAGTATTTTAGCTACCCGCTTGTTTGGCAGTGCTAT
CTGGCGGGCGACCAAGTCCACTTGCACGTTACATATGACTCGTCTGTGCTGGGCGAGAAGCAAGCGTCGTTGATG
GCTAATCAGTTTTGCCACGTTGTCGAGCAGCTCCTGGCACCAGACGTGCACCTTGAGACCAGCAGCGTCGTGGTC
GGTGATGTGACTCTCTGCGGGCCTCGGGACTTGGCCATTGTTACGGAGTGGAACAAGAAGCGCCAGGCCGAGATT
GTCTCTTCGACTTTGCACGAGTTGGTGGCGAAGCAGGCGAGGATGCGTCCGTCTTGTCCAGCCATTTATGCGTGG
GACGGCCAGCTGAGCTACCAAGAGCTGGATACCATCTCGACACGATGGGCTACCTATCTCTCCTACAAGTATCAT
GTCAAATCCGAGGAGCTGGTGCCGCTGTGTTTTGAAAAGTCACTCTGGTTCTACGTTGCCATGCTTGCTGTCAAT
AAGGCTGGTGGTGCTTGGCTGCCTCTAGACCCCTCACACCCTACACATCGGCACCAGGTGGTTGTCAAGCAAGCC
AAGGCCCGCATAATTTTAACGTCGCCAACGGCAGTGGAAAAGGCCCGGGGCCTGGCGCGGCATGTGGAGGTGCTT
TCCCCCGAGGCTGACAAGGCTGTCACAGAGACGCTACGCGACAATGGCATTGCCCTGTCGGTCAAGGCTGTGCAG
CCAAGCAACATTGCCTATGTGCTATTTACGTCTGGAACAACGGGCACGCCCAAGGGAATGGTTATGGAACACGGA
GCCTTGTGTTCAAGCATGACTGCTTCGAGTAAAAGACTGGGAATCGACCCAGACAATGTGCGCCAACTACAGTTT
GCGGCCTATGTGTTTGATTTGGCCATTGGCGAAATCATACCTGCGCTCATCTCGGGCGCTTGCATTTGTGTGCCA
TCTGAGCACCAGCGCCTCAATGACTTGTCGAGCTTTGTGGCTGAGTCGAGGGCAAATTGGGCCTATCTGACGCCT
TCATTTAGTCGCATCCTGTCTCCGACAGACGTGCCCGGTCTTGAAGTCCTCATGTTTGCGGGTGAGGCAGTTGGC
ACGGACCACTTGGCCAAGTGGTTTGGCCGTCTTCGTCTCATCAATGCATGGGGTCCATCAGAGGCGTGTTGTTTT
GCATCATTCCGCGAGTACGAGACGGTGGACGACTCGCCTCTAAACATTGGATTTCCAGTGGGAGCGCGAAGCTGG
ATTGTTGAACCAGACGACTACCACCGTCTGGTGCCAATTGGCTGTGTTGGAGAGATTATGCTGCAGGGGCCGACT
CTAGCCCGGGAATACCTGGCTTTTGAAGCGGGCACCAAGGCTAGCTTCATTACAGACTTGCCCGAGTGGGCGCCA
GACAGGGAGCAAGTGCCGTACTCGCGGTTTTACAAGTCGGGCGATCTCGGATACTATAACGCTGATGGAACCATG
GAATTTGTGGCGCGCAAGGACACTCAAGTAAAGATTCGCGGCTTCCGCATCGAGTTGGGAGAGGTTGAAAGTCAG
GTTCGCAATGCGGTTGGCGGCATTCAACAGGTGACTGTCGATGTTCTAAAGTCGCAAGGAGTTGATCGGCTCGTG
GCCTATCTATGCTATTCCTCGGCGATGCGAACACCTGAGAGTGGCAATTCAGACTTTTCAGACTTGCTGCTCCCC
ATGGACGAAACAATGACACAAGAGGCCGCTAGTCTCAAGAGTTTTCTCCAAGTAAGACTTCCCTTGTACATGGTG
CCAACAGTTTATATCCCTGTGCGGTATATGCCCTTTATTACATCGCAAAAGACGGATCGCAGGATACTGCGACAG
ACGGCGAGTTCCATTTCCAATGCAGAACTGGAACAGTACATGTTGGCAAATGCCACCAAGGAGCCGCCAGCCACA
GCCATGGAGACGCTTTTGCAGAGTCTCTGGGCCGACGTCTTGTCTATTCCGACGGAGCGAATTGGCCGCAACGAC
AGCTTTTTGCATCTAGGCGGCGACTCACTTGGCGCAATTCGCCTCATTACCAAGGCCCGACAACATGGCGTGCAA
CTGAGCGTGGCAAACATTTTCAAGGATGCTCGCTTGAGTCAAGTGGCGCTGGCTGCGCAAACGAGCATACAGGAC
GACGACATGTCTGTCGCTCCCTGGAGTCTGGTGCCGGCAGGGCAGAAAGAGGCTCTTGTTGGCGCTGCTGAGGAA
CAGTGTCGGGTGCATGAGCAAGGTTTGACGATTCAAGACATTTATCCCACGACGCCGCTGCAAGAGGGTCTCATG
GCATTGGCTGTGAAGCAAGCCGGATCCTACACAGCCAAGCTCAGCTTGGAGCTTGCCGGTGCCGACGTTGGCCGC
TTCAAAGCAGCCTGGGAATACACTCTTGGTGTGTGTGCGGCTCTCCGAACGCGAATCTTTAGACATGGGCCAGAC
ACAATGCAGGCCGTTCTCACAGGCCCGGCACAGTGGCAATCGTCGGCCATTGAGGCATGCAACATGGTGTACGGA
TCCGCACTCTGCCAATATGCTCTGTTTAGTCGAGGCGACGACACCGTCTTCTCCTTGGCTATGCATCATGCTATT
TTTGATGGATGGAGCTTATCAATTATTATGAAGACGCTGACGCAGGCCTATGAGGCTTCCGGCAATTTTGCTGCT
CTTGAGCCTCTTCCGCCCTACTCGCTCTTTATCCGCCATGTACGCAGCCTGGACCAGGTGCGAGCAGCCGAGTAT
TGGCGTGGACAGCTTCAAGGGGCCCTGTCTCCAGTATTTCCCCCACGGCCAACCTCGACATGTCCGCCCTTGTCG
AGTAAAACAGTGACGCAGCGCATTGCGCTCAAGAGTGCGTCTCAGCTTGCAGTAACAAAGGCTACCATTCTCCGC
GCTGCCTGGGCCATTGTTCTCGCCAAGCATAATGCCAATGCACAAGACATTACGTTTGGGGCGGCAGTGGCGGGC
CGCCAGGCGCCAGTCTATGGCATTGAGAGCATCGTGGGACCAGTCATTTCCACGGTGCCAATCCGCGTCAAGCTG
GATGAGGGGCAGTCTGCACAAGACTTTTTGAAGGCGATGCAAAGCCAAGCGGTTGAAATGATGCCCTATGAGCAC
ATGGGTATTCAGAATATTGCCCAACTTGGTGCTGATGCGCGTCAAGCCTGCGACTTTACCTCTTTGTTTGCCGTT
CAGCACCGCACTATTTTGTCGGGCGCACAAGCCTCCTTTTTGACCCAGTCTGGCAAGGACGGGGACAAGCAGCAG
ACGTCTAGCTATGCGACTTACTTTACCTATCCGCTCGTGGGACAGTGCTACCTGTTTGACGATGAAGCTGCGCTT
GAGCTCATTTACGATGGCTCCGCGCTCTCGGATGGACAGGCTGAGGCGTTTGCCGCTCAATACGAGCACATTGTG
CAACAGCTCTTGTCTGTACAAGTATCTGGACACGACGACTTGTGTGTTGGACAGCTAAGGCTGTGTGGCAGCTGG
GACGTGGAAAAGATTGAGCAGTGGCACGCGCAGGAGCCAGAGTTGACATTGGTTGAGTCGAGGATCCAAGACTTG
ATTGGCCAGACTGCCTCGTCTTGTCCCGACAAGGAGGCCATTTTGTCGTGGGATGGGAGGTGTACATATGCTCAA
CTAGAGCACATGACTTGCTTGCTGGCCCAGTATCTGGGTGCAAAGGGGGTGACGAAGGGATCGCGCGTGCCGATT
TGTTTTGAAAAGTCCATGTGGACCATTGTGGCCATGATGGGCATATTAAAAGCGGGAGGGGCGTTTGTGCCGCTG
AGTCCAGATCATCCGGCGAGTCGAAGGCGAGAGTTGGTGCGTGATTTGGGGGCAAAAGTTGTCGTTGTTTCCGAG
GCGACGCAAAAGGCGTGTAGTGATTTGGGGGTGAGGGTGGTTGTGCTGTCGGCGGGGTTGATGGGTGAGCTTTCG
AATTCTGACGACCATGAGCAAGTCGAGGCTATGAATGGAGACGACGAAGTGACGCCTGGTGGAGGCGCGGCATAT
GTGCTCTTTACCTCTGGCAGCACGGGCAAGCCCAAGGGCGTCATTGTCGACCACTATGCCATTGCATCGAGCATC
AAGGGCCACGGCACTGCCATGGGCCTGGGACCCGAGTCACGAGTCTTGCAGTTTTCCAACTACATCTTTGACGGA
TCCATTACCGAATGCCTCGCAACCTTGGTGTTTGGCGGTTGTGTGTGCGTGCCTGGTGACGAAGAGCGACTCGGA
GGATCTCTGAGCGATTTTATCCAGGCTTCACGCGTCAACTGGGCCATGCTTACCCCGTCGTTTGTGCGGACTCTA
GACCAAGGCCATGTGCCCACGCTCAAGACGCTGGTGCTTGGAGGTGAAGCACCAACACGAGACGTTATTGAGCCC
TGGCTTGGACGGGTGCGTCTGCTGAATGCCTATGGACCAGCAGAGGCGTCGGTCTGCATTGCCACCCATGTCATT
GAATCAGCAGCCTCACCGAGCGCAATTGGACGCGGGTGCAACGCTCGACTGTGGATCGTGGATCCCGAGGACCAA
GATTGTCTGGCTGGTGTGGGATGTGTTGGCGAGTTGGTGGTGCAAGGGCCAGGGCTTGCTCGAGGCTATCTCAAC
AATGAAGCAGCAACGGCGCGTGCCTTTATCAAGGCTCCGGCCTGGCTGCCTCGAGGTGCGTATGAGCGCGTCTAC
AAGACTGGCGATCTTGTGCGGTACAGCGACGACGGCACGATTGAATATGTTGGTCGCAAAGACACGCAAATCAAG
ATTCGCGGCCAGCGGTTAGAGTCGGGCGAGATTGAACACCACATGCGCGATCTGCTCCACGTGGCGCGCCAGGTT
GTCGTGACAAAGGCCCAGATTGCTGAGCAGGATGTCCTGGTGGCCTTTATTTGCACGACGAATGGCCAGACGCAG
TCGTTGGACTGTGGCCTTGCCGAAATGGATGACGGGCTTGTCCGGGCGTTTGTCGCCTTGTCGCAAGATTTGGCC
ACGCGCGTGCCGGCATACATGGTTCCCTCGTACTTTATTCCCGTGCGGGCCATGCCCGTGACGCCAACCGGGAAA
CTCAACACTAGGCTTCTTCAAGATGAGCTTCTCGGCATGAGTGTGGATGAGCTGCGGCAGTATGCAGCGTGCCAG
AGGGCTCCCTTTGAGGAGCCGCGCAACGAGACGGAATCTCGATTGCGGGGCCTATTCTCTCAGGTTTTGAATATC
TCGGAATCGCAAATCAGTATAAACGATGGGTTTAGCCAGCTTGGTGGCGATTCACTCAAAGTCGTGACATTGCAG
GGCCAGATTCGGCGGTGCTTTGACAAGATGTTGAGTATTCAGCTGCTCAACCGCCGGGCCATGTCTATTCGCATG
TTGGCTCCCTTGGTACTGGGCGAGACGACGGATGCTGGTGCCGCCGAGGAAGATTTTGGAAAAGTACTCACAACC
ATGTTGGATCAAATCTGGCCCATGGGCAACAAGATTCGGCAAGACTACGTTTCGGTTGATTTTGTACCGCAAGCT
CACGTCTTTCTTACGGGCGCAACGGGATATCTCGGCACGGCTCTCCTCCATCGCTTAGTGACGGAGTCGAGCATT
GAGAAAGTGACTGTGCTTGTGCGAGCAAAGACGCGGGCCCAGGCTCTAGAGAGGGTCAAACGGTCGGCTCGACTT
GGCGGCTGGTGGCACGAGGAATTCATGGCCAAGCTGCAAGTGTGGAAGGGAGACTTGGGCATGCGTGGCTTTGGC
CTGTCGCAAGATGAGTGGAGGGTGCTGACGAGTGGAGTGCATGCCATTGTGCATAATGGTGCGGCGGTGGATTGG
AGTGCTGATTTTGCGTCTCTCAAGGCGGTTAATGTGGACTCGACGCGGCAACTTGTTGAGATTGCACTGGCGTCG
CCGGCGCATCCCAGGTTGGTGTATGTGTCTGGTGGGGCGCATGTTGCTCAAGACGAGGACCGCGTGGCTGTTGCA
AGGTCGCTGTCTGGACAGAATCTTGGCTACAGCCAGACAAAGGTGCTCTCTGAGCTTCTTGTTGGCGAGTGTGCC
GCCCGACTACCTGCGCACCAAGACCAGCTCTCAGTCGTCAAGCCAGGACGCATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail