Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5216
Gene name
LocationContig_4:12379..12973
Strand-
Gene length (bp)594
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup462
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|441
Ophiocordyceps australis 1348a (Ghana) OphauG2|6170
Ophiocordyceps australis map64 (Brazil) OphauB2|215
Ophiocordyceps australis map64 (Brazil) OphauB2|231
Ophiocordyceps australis map64 (Brazil) OphauB2|4761
Ophiocordyceps australis map64 (Brazil) OphauB2|5216 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6110
Ophiocordyceps australis map64 (Brazil) OphauB2|612
Ophiocordyceps australis map64 (Brazil) OphauB2|6656

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5216
MRAAVAPGFWAEVIRRLPRIGQEIHQGKTSEEKLRIANKEISPLFQIWSYTPIGTLSAELANITAQGLVTSQGLR
IFVYTICNKTSFGIIVELMCPKKEVQVIVPKYHLHAAPEFLPPPDDEELRRGEEAMKRKEAQKIIKAWDLQQDAE
QVRWMRGEALRYTETEERELNIKVALLKSPQDLQQAAKGKLQREGNL*
Coding >OphauB2|5216
ATGCGAGCTGCGGTGGCGCCAGGATTCTGGGCCGAGGTGATCAGGAGATTGCCTCGAATTGGCCAGGAGATCCAC
CAAGGCAAAACGTCTGAGGAGAAACTGCGCATCGCTAACAAGGAAATTAGCCCTCTGTTTCAAATCTGGTCTTAT
ACACCAATAGGGACTTTGAGTGCCGAACTTGCCAACATCACTGCGCAAGGCCTAGTTACATCGCAAGGTTTGAGG
ATCTTCGTATATACAATTTGTAATAAAACGTCTTTTGGAATTATCGTGGAGCTCATGTGTCCGAAAAAAGAAGTC
CAAGTTATTGTGCCGAAATACCATTTACACGCAGCACCCGAGTTCCTTCCACCACCAGACGATGAGGAGTTAAGA
CGAGGAGAAGAGGCAATGAAGAGAAAGGAAGCACAAAAGATAATCAAGGCTTGGGACCTCCAACAAGATGCCGAA
CAGGTACGATGGATGCGAGGGGAGGCTCTACGGTACACTGAGACGGAAGAGAGGGAACTTAATATAAAGGTCGCA
CTGCTTAAGAGCCCGCAAGATCTTCAACAGGCCGCCAAGGGGAAGCTCCAGCGGGAGGGTAACCTCTAA
Transcript >OphauB2|5216
ATGCGAGCTGCGGTGGCGCCAGGATTCTGGGCCGAGGTGATCAGGAGATTGCCTCGAATTGGCCAGGAGATCCAC
CAAGGCAAAACGTCTGAGGAGAAACTGCGCATCGCTAACAAGGAAATTAGCCCTCTGTTTCAAATCTGGTCTTAT
ACACCAATAGGGACTTTGAGTGCCGAACTTGCCAACATCACTGCGCAAGGCCTAGTTACATCGCAAGGTTTGAGG
ATCTTCGTATATACAATTTGTAATAAAACGTCTTTTGGAATTATCGTGGAGCTCATGTGTCCGAAAAAAGAAGTC
CAAGTTATTGTGCCGAAATACCATTTACACGCAGCACCCGAGTTCCTTCCACCACCAGACGATGAGGAGTTAAGA
CGAGGAGAAGAGGCAATGAAGAGAAAGGAAGCACAAAAGATAATCAAGGCTTGGGACCTCCAACAAGATGCCGAA
CAGGTACGATGGATGCGAGGGGAGGCTCTACGGTACACTGAGACGGAAGAGAGGGAACTTAATATAAAGGTCGCA
CTGCTTAAGAGCCCGCAAGATCTTCAACAGGCCGCCAAGGGGAAGCTCCAGCGGGAGGGTAACCTCTAA
Gene >OphauB2|5216
ATGCGAGCTGCGGTGGCGCCAGGATTCTGGGCCGAGGTGATCAGGAGATTGCCTCGAATTGGCCAGGAGATCCAC
CAAGGCAAAACGTCTGAGGAGAAACTGCGCATCGCTAACAAGGAAATTAGCCCTCTGTTTCAAATCTGGTCTTAT
ACACCAATAGGGACTTTGAGTGCCGAACTTGCCAACATCACTGCGCAAGGCCTAGTTACATCGCAAGGTTTGAGG
ATCTTCGTATATACAATTTGTAATAAAACGTCTTTTGGAATTATCGTGGAGCTCATGTGTCCGAAAAAAGAAGTC
CAAGTTATTGTGCCGAAATACCATTTACACGCAGCACCCGAGTTCCTTCCACCACCAGACGATGAGGAGTTAAGA
CGAGGAGAAGAGGCAATGAAGAGAAAGGAAGCACAAAAGATAATCAAGGCTTGGGACCTCCAACAAGATGCCGAA
CAGGTACGATGGATGCGAGGGGAGGCTCTACGGTACACTGAGACGGAAGAGAGGGAACTTAATATAAAGGTCGCA
CTGCTTAAGAGCCCGCAAGATCTTCAACAGGCCGCCAAGGGGAAGCTCCAGCGGGAGGGTAACCTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail