Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5213
Gene name
LocationContig_399:795..1924
Strand+
Gene length (bp)1129
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 200 330 3.0E-11
sp|Q871C5|MEP1_NEUCR Extracellular metalloprotease NCU07200 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8G12.220 PE=3 SV=1 192 345 6.0E-08
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 200 345 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5213
MKRLGSKAAVFIALTSLLAGAVPSIFECARNPCYNDLLYMSGSTAHLKSDCLSGKLSPGIKDIVIARAFLPSNPG
CGHESRRKTRTYTSNDFRPVCDCLIPALVPRHCDSTRCYTELFEAADKSILTLREQCGTYQGKDVSIPMSSLQSQ
PTCGAQHGDTLVLNEDDYRDVCNCIRSSYDKAYPASDRVISGHMLSEHYIDVFLHIIVLSKSSLRAKRYKRKGEL
ESEFRHLVQPLAETGIKFVVKSIDLTVDATWAMGKNNEAMRKALHKGDNRDLNFYMIDTLNGMDRDFAPLTRTLK
TYCTPPSMSDVWKSERIGDPILDGCIVTTGVTQHTTSMALQRWIGTCKLETK*
Coding >OphauB2|5213
ATGAAGCGACTGGGTAGTAAAGCCGCCGTTTTCATTGCCTTGACCAGCTTGCTAGCTGGAGCGGTCCCTTCCATC
TTCGAATGCGCTCGAAATCCGTGCTATAATGATCTTTTATACATGTCAGGGTCTACTGCGCACCTTAAAAGCGAT
TGCTTATCTGGCAAGTTGAGTCCCGGCATCAAGGACATAGTCATCGCCAGAGCCTTTCTCCCCTCTAATCCAGGC
TGTGGCCATGAATCGCGCCGAAAGACTCGCACTTATACCTCTAACGACTTCCGCCCCGTGTGCGATTGCTTGATC
CCGGCTCTTGTGCCTAGACACTGCGATAGTACCCGTTGCTACACGGAGCTATTCGAGGCAGCCGACAAGTCCATC
TTGACGCTGCGCGAGCAATGCGGAACCTACCAAGGCAAAGATGTCTCGATTCCTATGTCTTCACTTCAAAGCCAG
CCAACATGTGGCGCCCAACATGGCGACACGCTTGTTCTAAACGAGGATGATTATAGGGATGTGTGTAACTGCATC
CGCAGCAGCTACGACAAGGCCTACCCAGCCAGTGATAGAGTGATCAGCGGACACATGCTTTCAGAGCATTACATT
GATGTCTTCTTACACATTATCGTTCTATCCAAGTCGAGCTTACGCGCAAAAAGGTATAAACGAAAAGGAGAACTA
GAATCAGAGTTTCGGCACCTTGTTCAGCCGCTAGCCGAGACAGGAATCAAATTTGTGGTCAAGTCTATAGACCTT
ACTGTTGACGCTACGTGGGCAATGGGCAAAAATAACGAGGCTATGCGAAAAGCGCTTCACAAGGGCGATAATCGC
GACCTTAACTTCTACATGATTGATACGTTGAATGGCATGGATCGCGACTTTGCGCCTCTAACAAGGACTCTTAAG
ACGTACTGCACTCCGCCTTCCATGAGCGACGTTTGGAAATCAGAAAGAATCGGCGATCCTATTCTCGATGGCTGC
ATCGTGACAACGGGCGTGACGCAGCATACTACTTCAATGGCCTTGCAGCGTTGGATCGGGACATGCAAACTGGAA
ACAAAGTAG
Transcript >OphauB2|5213
ATGAAGCGACTGGGTAGTAAAGCCGCCGTTTTCATTGCCTTGACCAGCTTGCTAGCTGGAGCGGTCCCTTCCATC
TTCGAATGCGCTCGAAATCCGTGCTATAATGATCTTTTATACATGTCAGGGTCTACTGCGCACCTTAAAAGCGAT
TGCTTATCTGGCAAGTTGAGTCCCGGCATCAAGGACATAGTCATCGCCAGAGCCTTTCTCCCCTCTAATCCAGGC
TGTGGCCATGAATCGCGCCGAAAGACTCGCACTTATACCTCTAACGACTTCCGCCCCGTGTGCGATTGCTTGATC
CCGGCTCTTGTGCCTAGACACTGCGATAGTACCCGTTGCTACACGGAGCTATTCGAGGCAGCCGACAAGTCCATC
TTGACGCTGCGCGAGCAATGCGGAACCTACCAAGGCAAAGATGTCTCGATTCCTATGTCTTCACTTCAAAGCCAG
CCAACATGTGGCGCCCAACATGGCGACACGCTTGTTCTAAACGAGGATGATTATAGGGATGTGTGTAACTGCATC
CGCAGCAGCTACGACAAGGCCTACCCAGCCAGTGATAGAGTGATCAGCGGACACATGCTTTCAGAGCATTACATT
GATGTCTTCTTACACATTATCGTTCTATCCAAGTCGAGCTTACGCGCAAAAAGGTATAAACGAAAAGGAGAACTA
GAATCAGAGTTTCGGCACCTTGTTCAGCCGCTAGCCGAGACAGGAATCAAATTTGTGGTCAAGTCTATAGACCTT
ACTGTTGACGCTACGTGGGCAATGGGCAAAAATAACGAGGCTATGCGAAAAGCGCTTCACAAGGGCGATAATCGC
GACCTTAACTTCTACATGATTGATACGTTGAATGGCATGGATCGCGACTTTGCGCCTCTAACAAGGACTCTTAAG
ACGTACTGCACTCCGCCTTCCATGAGCGACGTTTGGAAATCAGAAAGAATCGGCGATCCTATTCTCGATGGCTGC
ATCGTGACAACGGGCGTGACGCAGCATACTACTTCAATGGCCTTGCAGCGTTGGATCGGGACATGCAAACTGGAA
ACAAAGTAG
Gene >OphauB2|5213
ATGAAGCGACTGGGTAGTAAAGCCGCCGTTTTCATTGCCTTGACCAGCTTGCTAGCTGGAGCGGTCCCTTCCATC
TTCGAATGCGCTCGAAATCCGTGCTATAATGATCTTTTATACATGTCAGGGTCTACTGCGCACCTTAAAAGCGAT
TGCTTATCTGGCAAGTTGAGTCCCGGCATCAAGGACATAGTCATCGCCAGAGCCTTTCTCCCCTCTAATCCAGGC
TGTGGCCATGAATCGCGCCGAAAGACTCGCACTTATACCTCTAACGACTTCCGCCCCGTGTGCGATTGCTTGATC
CCGGCTCTTGTGCCTAGACACTGCGATAGTACCCGTTGCTACACGGAGCTATTCGAGGCAGCCGACAAGTCCATC
TTGACGCTGCGCGAGCAATGCGGAACCTACCAAGGCAAAGATGTCTCGATTCCTATGTCTTCACTTCAAAGCCAG
CCAACATGTGGCGCCCAACATGGCGACACGCTTGTTCTAAACGAGGATGATTATAGGGATGTGTGTAACTGCATC
CGCAGCAGCTACGACAAGGCCTACCCAGCCAGTGATAGAGTGATCAGCGGACACATGCTTTCAGAGCATTACATT
GATGTCTTCTTACACATTATCGTTCTATCCAAGTCGAGCTTACGCGCAAAAAGGGTAATGCTTATATTTTCCCTT
ACTATAAAAGACATTCGACGGGATATTAGATGCTAAGTCCTGAATTTAGTATAAACGAAAAGGAGAACTAGAATC
AGAGTTTCGGCACCTTGTTCAGCCGCTAGCCGAGACAGGAATCAAATTTGTGGTCAAGTCTATAGACCTTACTGT
TGACGCTACGTGGGCAATGGGCAAAAATAACGAGGCTATGCGAAAAGCGCTTCACAAGGGCGATAATCGCGACCT
TAACTTCTACATGATTGATACGTTGAATGGCATGGATCGCGACTTTGCGCCTCTAACAAGGACTCTTAAGACGTA
CTGCACTCCGCCTTCCATGAGCGACGTTTGGAAATCAGAAAGAATCGGCGATCCTATTCTCGATGGCTGCATCGT
GACAACGGGCGTGACGCAGCATACTACTTCAATGGCCTTGCAGCGTTGGATCGGGACATGCAAACTGGAAACAAA
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail