Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5201
Gene name
LocationContig_391:100..3636
Strand-
Gene length (bp)3536
Transcript length (bp)3357
Coding sequence length (bp)3357
Protein length (aa) 1119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 1.4E-66 760 1009
PF00501 AMP-binding AMP-binding enzyme 1.1E-65 24 489
PF00550 PP-binding Phosphopantetheine attachment site 2.4E-11 640 702
PF01370 Epimerase NAD dependent epimerase/dehydratase family 8.2E-11 758 967
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 2.8E-05 498 602
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.2E-05 760 995

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2 1104 0.0E+00
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 4 1106 0.0E+00
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2 1104 0.0E+00
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1 1103 0.0E+00
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 3 1104 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2 1104 0.0E+00
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 4 1106 0.0E+00
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2 1104 0.0E+00
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1 1103 0.0E+00
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 3 1104 0.0E+00
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 4 1104 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 47 1088 5.0E-100
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 19 704 4.0E-67
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 24 705 7.0E-65
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 21 715 3.0E-63
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 19 700 4.0E-63
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2 704 6.0E-63
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 14 721 3.0E-62
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 24 702 2.0E-61
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 20 728 5.0E-61
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 19 704 5.0E-60
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 17 703 7.0E-60
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 50 703 7.0E-60
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 19 699 1.0E-59
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 11 703 5.0E-59
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 24 704 2.0E-58
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 24 697 6.0E-58
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 13 703 6.0E-58
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 35 700 2.0E-57
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 24 731 2.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 19 705 4.0E-57
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 19 704 1.0E-56
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 19 704 1.0E-56
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 24 762 3.0E-56
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 24 708 4.0E-56
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 12 724 7.0E-56
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 24 708 1.0E-55
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 19 721 3.0E-55
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 17 704 3.0E-55
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 19 721 4.0E-55
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 24 714 5.0E-55
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 24 696 6.0E-55
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 20 703 1.0E-54
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 24 714 1.0E-54
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 50 674 2.0E-54
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 24 742 2.0E-54
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 21 705 5.0E-54
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 24 719 8.0E-54
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 19 719 8.0E-54
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 50 704 1.0E-53
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 14 716 1.0E-53
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 24 703 4.0E-53
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 24 703 6.0E-53
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 24 696 7.0E-53
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 24 703 7.0E-53
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 12 724 8.0E-53
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 24 700 1.0E-52
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 19 700 2.0E-52
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 47 696 2.0E-52
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 42 696 2.0E-52
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 19 703 9.0E-52
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 24 714 1.0E-51
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 19 703 7.0E-51
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 19 696 8.0E-51
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 24 721 1.0E-50
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 19 703 2.0E-50
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 19 703 3.0E-50
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 20 700 4.0E-50
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 12 704 4.0E-50
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 670 1061 5.0E-50
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 19 696 1.0E-49
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 31 1059 4.0E-49
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 24 720 5.0E-49
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 24 696 5.0E-49
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 47 706 4.0E-48
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 19 783 1.0E-47
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 24 703 2.0E-47
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 19 696 5.0E-47
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 24 715 1.0E-46
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 24 710 1.0E-46
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 47 696 2.0E-46
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 24 700 5.0E-46
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 19 708 9.0E-46
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 19 708 1.0E-45
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 48 705 1.0E-45
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 13 705 2.0E-45
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 19 696 2.0E-45
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 24 706 3.0E-45
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 25 704 3.0E-45
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 47 696 4.0E-45
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 25 704 5.0E-45
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 49 709 3.0E-44
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 25 704 3.0E-44
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 9 699 4.0E-42
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 49 696 2.0E-41
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 24 721 3.0E-40
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 19 703 4.0E-40
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 24 722 9.0E-40
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 24 723 1.0E-39
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 195 975 2.0E-38
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 13 714 4.0E-38
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 46 531 1.0E-37
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 40 706 2.0E-37
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 5 703 3.0E-37
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 24 703 3.0E-36
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 24 725 6.0E-36
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 24 725 7.0E-36
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 49 706 6.0E-35
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 8 712 7.0E-35
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 24 703 2.0E-34
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 42 704 4.0E-34
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 17 709 2.0E-33
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 49 777 4.0E-33
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 42 697 5.0E-33
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 51 604 5.0E-33
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 47 709 5.0E-33
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 47 709 6.0E-33
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 29 614 1.0E-32
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 50 608 2.0E-32
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 24 732 2.0E-32
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3 709 3.0E-32
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 21 679 3.0E-32
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 39 716 3.0E-32
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 21 679 3.0E-32
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 37 608 6.0E-32
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 35 756 7.0E-32
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 50 608 2.0E-31
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 32 700 3.0E-31
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 34 703 3.0E-31
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 26 700 5.0E-31
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 50 608 7.0E-31
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 50 703 1.0E-30
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 22 678 2.0E-30
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 38 608 2.0E-30
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 38 608 2.0E-30
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 38 608 2.0E-30
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 38 608 2.0E-30
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 38 608 2.0E-30
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 14 702 4.0E-30
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 50 679 4.0E-30
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 38 608 4.0E-30
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 38 608 4.0E-30
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 38 608 4.0E-30
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 38 608 4.0E-30
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 50 608 5.0E-30
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 50 608 8.0E-30
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 50 608 8.0E-30
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 24 698 1.0E-29
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 51 716 1.0E-29
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 50 608 1.0E-29
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 38 608 1.0E-29
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 38 608 1.0E-29
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 50 608 2.0E-29
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 24 700 2.0E-29
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 24 700 2.0E-29
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 24 700 2.0E-29
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 34 695 3.0E-29
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 50 608 4.0E-29
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 4 703 4.0E-29
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 76 693 4.0E-29
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 34 695 4.0E-29
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 50 608 8.0E-29
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 49 679 1.0E-28
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 47 608 1.0E-28
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 50 608 1.0E-28
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2 723 2.0E-28
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 42 697 2.0E-28
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 14 705 5.0E-28
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 14 705 5.0E-28
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 30 608 6.0E-28
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 49 704 6.0E-28
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 50 608 6.0E-28
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 50 608 1.0E-27
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 51 608 4.0E-27
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 51 608 5.0E-27
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 51 608 5.0E-27
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 51 608 5.0E-27
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 203 605 6.0E-27
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 51 608 7.0E-27
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 51 608 7.0E-27
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 51 608 8.0E-27
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 51 608 8.0E-27
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 51 608 8.0E-27
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 51 604 1.0E-26
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 51 604 1.0E-26
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 51 604 1.0E-26
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 51 608 1.0E-26
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 51 608 1.0E-26
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 23 604 1.0E-26
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 51 604 2.0E-26
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 51 604 5.0E-26
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 51 604 5.0E-26
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 51 604 5.0E-26
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 51 604 5.0E-26
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 42 715 7.0E-26
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 51 604 2.0E-25
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 51 604 2.0E-25
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 47 608 2.0E-25
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 50 702 8.0E-25
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 51 604 3.0E-24
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 30 605 5.0E-24
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 33 700 7.0E-24
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 183 1084 7.0E-24
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 50 608 2.0E-23
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 50 608 2.0E-23
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 50 608 2.0E-23
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 50 608 2.0E-23
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 50 608 2.0E-23
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 50 608 2.0E-23
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 50 608 2.0E-23
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 50 608 2.0E-23
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 50 608 3.0E-23
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 50 608 6.0E-23
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 50 608 6.0E-23
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 50 608 6.0E-23
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 50 608 6.0E-23
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 50 608 6.0E-23
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 50 608 6.0E-23
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 191 532 9.0E-23
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 50 696 2.0E-22
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 50 696 3.0E-22
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 50 608 3.0E-22
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 39 608 3.0E-22
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 39 703 4.0E-21
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 453 1093 4.0E-21
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 24 605 1.0E-20
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 20 608 1.0E-20
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 757 1017 2.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 51 679 2.0E-20
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 42 711 5.0E-20
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 24 532 1.0E-19
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 14 674 1.0E-19
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 24 734 3.0E-18
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 19 608 4.0E-18
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 662 1059 7.0E-18
sp|O74419|YQ52_SCHPO Uncharacterized protein C162.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.02c PE=2 SV=1 50 993 2.0E-17
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 47 731 3.0E-17
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 757 1017 9.0E-17
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 203 530 5.0E-16
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 758 992 7.0E-16
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 752 1063 4.0E-15
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 753 1058 5.0E-15
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 737 1059 2.0E-14
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 759 1057 1.0E-13
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 203 639 2.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 453 679 2.0E-13
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 759 1063 4.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 49 704 5.0E-13
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 758 1059 5.0E-13
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 758 1059 7.0E-13
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 759 1057 2.0E-12
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 48 506 2.0E-12
sp|P55912|PRPE_SALTY Propionate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpE PE=3 SV=2 31 535 2.0E-12
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 34 608 3.0E-12
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 759 1063 3.0E-12
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 757 1063 7.0E-12
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 21 608 7.0E-12
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 571 700 2.0E-11
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 395 691 9.0E-11
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 759 1063 1.0E-10
sp|P77495|PRPE_ECOLI Propionate--CoA ligase OS=Escherichia coli (strain K12) GN=prpE PE=3 SV=1 31 532 2.0E-10
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 34 608 2.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 43 608 3.0E-10
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 34 608 1.0E-09
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 758 1058 1.0E-09
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 570 733 2.0E-09
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 570 733 3.0E-09
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 196 668 8.0E-09
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 183 605 8.0E-09
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 571 710 5.0E-08
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 24 529 6.0E-08
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 31 296 6.0E-08
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 39 563 6.0E-08
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 22 608 6.0E-08
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 34 608 8.0E-07
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 34 608 8.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 34 605 2.0E-06
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 66 535 2.0E-06
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 48 608 3.0E-06
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 48 608 3.0E-06
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 50 223 5.0E-06
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 50 223 5.0E-06
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 50 223 5.0E-06
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 43 530 5.0E-06
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 48 608 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0050662 coenzyme binding Yes
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0048037 cofactor binding No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0016229 steroid dehydrogenase activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008202 steroid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5201
MACLPDPTSDLDWSGYAGSIQWHFSEQAKMNPHRQCVIETKSINAPQRSFTYKQIYQASNILGHHLHQAGITHGD
VVMIWAHRSVDLVVAIMGTLASGATISILDPLYPPTRQQIYLEVAQPCALINIARATDESGPLAPTVRRYIDEAL
NLKTEVPFLRLQDDGFLSSGPLDGHDIFAHVRSKAASSPDIIVGPDSNPTLSFTSGSEGRPKGVLGRHYSLTKYF
SWMSKKFNLSSNSKFTLLSGIAHDPVQRDIFTPLFLGAQLLVPSGEDIQHEKLAEWFREYKPTVTHLTPAMGQIL
VGGATARFPCLDRAFFVGDILTTRDCRSLRRLAVNCNIVNMYGTTETQRAVSYYEIPSLSREPDYLDKLKDTVPA
GKGMENVQLLVVDRQFLRRLCDIGEIGEIYVRAAGLAEGYRNDKALNDERFLNSWFVDNDTWVQADAKSAKGEPW
RAYFKGPRDRLYRTGDLGRYLESGNVECTGRADDQVKIRGFRIELNDIDSNLSQNPLVRDCKTLVRRDKNEEPTL
VSYVVPELNEWPKYLSARGLNDVEDQGTRIGPATVYVKRFQCMQIELRDNLKGRLPSYAIPTTFIFLDKLPLNPN
GKVDKPNLPFPDIAEQTKEASGEEVERWRTMTETERIVATKWADLISGLNPKTIAPQDNFFDLGGHSLLAQQMLL
VIRKELGAKISINTLYEFPTLAGFSTRVDRHLSPISDEIEEMNPKDGQDSVYAASLKVLSAQLPASFLSIDAGTL
NSQHPLTIFLTGATGFLGAYLIHDLLGRAGHRVSLIAHVRNAKDSEAARSRLQLSLEGYGLWHDEWSDRLTCVVG
DLTKTRLGMDMDSWNHVAKTAEVVIHNGATVHWVKRYQDLLAANVISTLDALRLCNEGKPKTFTFISSTSVLDTD
YYIQLSEKQVHTGQGAVSEDDDMMGSCSGLGTGYGQTKWVSEQLVREAGRRGLIGSVVRPGYILGDTNNGVCNTD
DFLIRLLKGCVQLGMRPRIINSVNSVPVNHVARVVSAAALNPIGEGVYVVHVTGHPRLRMNEYLSLLEYYGFKAR
EVGYNEWKDELEKYVFAGGQDKDQEQHALMPLYHFCIDDLPATTRAPELDDENATGQQAMAGLYRIFN*
Coding >OphauB2|5201
ATGGCTTGCTTGCCAGATCCGACGAGCGACCTAGACTGGTCCGGCTATGCTGGCTCTATACAATGGCACTTCAGC
GAGCAAGCCAAGATGAATCCGCATCGCCAATGCGTCATCGAAACCAAGTCTATAAATGCTCCTCAACGCTCCTTT
ACCTACAAGCAAATCTATCAGGCGTCGAACATCCTTGGTCACCATTTGCATCAGGCAGGAATTACGCATGGCGAC
GTCGTCATGATCTGGGCCCATAGGTCTGTGGACCTAGTAGTGGCTATTATGGGCACTCTTGCCTCTGGCGCAACC
ATAAGCATTCTTGATCCTCTCTACCCCCCAACTCGCCAGCAGATCTATCTCGAAGTCGCTCAACCTTGTGCACTC
ATAAATATCGCCCGCGCCACTGACGAATCAGGGCCTCTTGCCCCTACCGTTCGGAGATATATCGATGAAGCACTG
AATTTAAAAACCGAAGTCCCTTTTCTTCGCCTCCAAGACGACGGATTCTTATCAAGCGGCCCTCTGGATGGGCAC
GACATTTTTGCCCATGTAAGATCGAAGGCCGCCTCGAGCCCAGACATCATTGTCGGACCGGATAGCAACCCAACT
CTTTCCTTCACCTCAGGCAGTGAGGGACGGCCAAAGGGAGTCCTCGGGCGGCACTACAGTCTCACTAAGTACTTC
TCGTGGATGTCTAAAAAGTTCAATCTTAGCTCAAATAGCAAGTTCACTCTGCTCTCTGGTATTGCCCATGATCCA
GTACAGAGAGATATCTTCACACCTCTCTTTCTCGGAGCACAGCTTCTTGTTCCATCAGGAGAGGACATACAACAC
GAGAAGCTAGCGGAATGGTTTAGAGAGTATAAGCCAACTGTCACTCATCTTACTCCCGCCATGGGCCAGATCCTT
GTTGGTGGAGCTACAGCCAGATTTCCCTGTCTAGACCGAGCTTTCTTTGTAGGTGACATCCTCACCACAAGAGAC
TGTAGGAGTTTGCGACGCCTCGCGGTTAATTGCAACATTGTCAACATGTACGGAACCACGGAGACTCAGCGAGCC
GTGAGTTACTACGAAATACCTAGTTTGTCCCGAGAACCCGACTACCTGGACAAGCTCAAAGATACTGTTCCCGCC
GGAAAGGGCATGGAAAACGTTCAACTTCTTGTAGTTGATCGGCAGTTTCTACGGAGGCTATGCGACATCGGAGAG
ATTGGGGAGATCTATGTTCGAGCCGCTGGCCTCGCAGAAGGCTATAGAAACGACAAAGCTTTGAATGATGAAAGG
TTTTTGAACAGCTGGTTCGTCGACAATGACACCTGGGTGCAAGCAGATGCCAAATCGGCGAAAGGCGAACCCTGG
AGAGCATATTTCAAGGGACCGCGTGACAGGCTGTATCGCACCGGCGACTTGGGACGCTATCTTGAGTCTGGCAAT
GTCGAGTGTACCGGACGCGCCGATGACCAAGTTAAAATTCGAGGCTTTCGAATCGAGCTCAACGATATCGATAGT
AATTTAAGTCAAAACCCTCTGGTGAGAGATTGCAAGACACTTGTTCGGCGAGACAAGAACGAGGAGCCAACATTA
GTGAGCTACGTCGTCCCAGAACTCAATGAATGGCCCAAGTATTTGTCTGCCCGGGGACTGAACGATGTAGAAGAT
CAGGGAACAAGGATTGGTCCAGCAACAGTCTACGTCAAACGCTTCCAGTGCATGCAGATCGAGCTGCGTGATAAT
CTCAAAGGTCGTTTACCAAGTTACGCCATACCAACCACATTTATCTTTCTTGACAAGTTGCCTCTGAACCCGAAT
GGCAAGGTCGACAAGCCCAACTTGCCATTCCCAGACATCGCAGAGCAAACAAAGGAGGCCTCCGGTGAAGAAGTC
GAGCGATGGAGGACGATGACGGAAACAGAACGTATCGTGGCTACTAAATGGGCCGACTTAATTTCTGGTCTGAAT
CCCAAAACTATTGCTCCGCAAGATAACTTCTTCGACCTTGGTGGGCATAGTCTATTGGCACAGCAGATGCTGCTT
GTTATTCGCAAGGAACTGGGTGCAAAAATTTCTATCAACACCCTCTATGAATTCCCGACCCTGGCGGGATTTAGT
ACACGAGTCGATCGACACTTAAGTCCGATATCGGATGAGATTGAAGAAATGAACCCAAAAGACGGCCAGGACTCG
GTATACGCTGCCTCTCTCAAGGTGCTCTCCGCGCAGCTGCCAGCTTCATTTCTGTCGATAGACGCGGGAACATTG
AATTCTCAGCACCCCCTGACAATTTTTCTCACGGGTGCTACTGGATTTCTAGGGGCGTATCTTATCCATGATTTG
TTAGGACGAGCAGGCCATCGGGTCTCCTTGATTGCTCACGTACGAAACGCCAAGGACTCAGAGGCTGCCAGGTCA
CGCCTGCAGCTCTCTTTGGAGGGCTATGGACTTTGGCATGACGAATGGTCAGATCGACTTACTTGCGTCGTTGGC
GACCTTACCAAGACGCGACTTGGCATGGACATGGACTCATGGAATCATGTGGCCAAGACTGCCGAAGTGGTGATA
CACAACGGAGCCACTGTTCACTGGGTAAAGCGTTATCAAGACTTATTGGCGGCTAATGTTATTTCAACCTTGGAT
GCTTTGCGGTTGTGTAACGAGGGCAAGCCAAAGACGTTCACATTTATCAGCTCGACGAGCGTCCTTGACACTGAT
TACTATATTCAACTATCTGAGAAGCAAGTTCACACCGGCCAGGGTGCTGTGTCCGAGGATGATGATATGATGGGG
AGCTGCAGTGGTTTAGGCACGGGCTACGGGCAGACTAAATGGGTATCGGAGCAACTAGTACGAGAAGCTGGCCGG
CGAGGACTTATTGGATCTGTGGTGCGCCCAGGGTATATATTGGGAGATACCAACAATGGCGTCTGCAACACGGAC
GACTTCTTGATACGACTGCTCAAGGGATGCGTCCAGCTTGGGATGCGGCCCCGAATCATCAACTCGGTCAACTCG
GTCCCTGTTAACCATGTGGCCCGTGTTGTTTCAGCGGCGGCACTTAACCCGATTGGCGAGGGAGTGTATGTTGTG
CATGTCACAGGCCATCCGCGGCTTCGCATGAATGAATACCTCTCGTTGCTCGAATATTATGGTTTCAAGGCGCGC
GAGGTTGGCTATAACGAGTGGAAAGATGAACTGGAGAAGTACGTCTTTGCTGGTGGACAAGATAAAGACCAGGAG
CAGCACGCACTGATGCCCCTCTATCATTTTTGCATCGACGACCTACCCGCAACCACGAGGGCACCTGAGCTTGAT
GACGAGAACGCGACTGGCCAACAGGCAATGGCCGGCCTTTACCGCATATTCAACTAG
Transcript >OphauB2|5201
ATGGCTTGCTTGCCAGATCCGACGAGCGACCTAGACTGGTCCGGCTATGCTGGCTCTATACAATGGCACTTCAGC
GAGCAAGCCAAGATGAATCCGCATCGCCAATGCGTCATCGAAACCAAGTCTATAAATGCTCCTCAACGCTCCTTT
ACCTACAAGCAAATCTATCAGGCGTCGAACATCCTTGGTCACCATTTGCATCAGGCAGGAATTACGCATGGCGAC
GTCGTCATGATCTGGGCCCATAGGTCTGTGGACCTAGTAGTGGCTATTATGGGCACTCTTGCCTCTGGCGCAACC
ATAAGCATTCTTGATCCTCTCTACCCCCCAACTCGCCAGCAGATCTATCTCGAAGTCGCTCAACCTTGTGCACTC
ATAAATATCGCCCGCGCCACTGACGAATCAGGGCCTCTTGCCCCTACCGTTCGGAGATATATCGATGAAGCACTG
AATTTAAAAACCGAAGTCCCTTTTCTTCGCCTCCAAGACGACGGATTCTTATCAAGCGGCCCTCTGGATGGGCAC
GACATTTTTGCCCATGTAAGATCGAAGGCCGCCTCGAGCCCAGACATCATTGTCGGACCGGATAGCAACCCAACT
CTTTCCTTCACCTCAGGCAGTGAGGGACGGCCAAAGGGAGTCCTCGGGCGGCACTACAGTCTCACTAAGTACTTC
TCGTGGATGTCTAAAAAGTTCAATCTTAGCTCAAATAGCAAGTTCACTCTGCTCTCTGGTATTGCCCATGATCCA
GTACAGAGAGATATCTTCACACCTCTCTTTCTCGGAGCACAGCTTCTTGTTCCATCAGGAGAGGACATACAACAC
GAGAAGCTAGCGGAATGGTTTAGAGAGTATAAGCCAACTGTCACTCATCTTACTCCCGCCATGGGCCAGATCCTT
GTTGGTGGAGCTACAGCCAGATTTCCCTGTCTAGACCGAGCTTTCTTTGTAGGTGACATCCTCACCACAAGAGAC
TGTAGGAGTTTGCGACGCCTCGCGGTTAATTGCAACATTGTCAACATGTACGGAACCACGGAGACTCAGCGAGCC
GTGAGTTACTACGAAATACCTAGTTTGTCCCGAGAACCCGACTACCTGGACAAGCTCAAAGATACTGTTCCCGCC
GGAAAGGGCATGGAAAACGTTCAACTTCTTGTAGTTGATCGGCAGTTTCTACGGAGGCTATGCGACATCGGAGAG
ATTGGGGAGATCTATGTTCGAGCCGCTGGCCTCGCAGAAGGCTATAGAAACGACAAAGCTTTGAATGATGAAAGG
TTTTTGAACAGCTGGTTCGTCGACAATGACACCTGGGTGCAAGCAGATGCCAAATCGGCGAAAGGCGAACCCTGG
AGAGCATATTTCAAGGGACCGCGTGACAGGCTGTATCGCACCGGCGACTTGGGACGCTATCTTGAGTCTGGCAAT
GTCGAGTGTACCGGACGCGCCGATGACCAAGTTAAAATTCGAGGCTTTCGAATCGAGCTCAACGATATCGATAGT
AATTTAAGTCAAAACCCTCTGGTGAGAGATTGCAAGACACTTGTTCGGCGAGACAAGAACGAGGAGCCAACATTA
GTGAGCTACGTCGTCCCAGAACTCAATGAATGGCCCAAGTATTTGTCTGCCCGGGGACTGAACGATGTAGAAGAT
CAGGGAACAAGGATTGGTCCAGCAACAGTCTACGTCAAACGCTTCCAGTGCATGCAGATCGAGCTGCGTGATAAT
CTCAAAGGTCGTTTACCAAGTTACGCCATACCAACCACATTTATCTTTCTTGACAAGTTGCCTCTGAACCCGAAT
GGCAAGGTCGACAAGCCCAACTTGCCATTCCCAGACATCGCAGAGCAAACAAAGGAGGCCTCCGGTGAAGAAGTC
GAGCGATGGAGGACGATGACGGAAACAGAACGTATCGTGGCTACTAAATGGGCCGACTTAATTTCTGGTCTGAAT
CCCAAAACTATTGCTCCGCAAGATAACTTCTTCGACCTTGGTGGGCATAGTCTATTGGCACAGCAGATGCTGCTT
GTTATTCGCAAGGAACTGGGTGCAAAAATTTCTATCAACACCCTCTATGAATTCCCGACCCTGGCGGGATTTAGT
ACACGAGTCGATCGACACTTAAGTCCGATATCGGATGAGATTGAAGAAATGAACCCAAAAGACGGCCAGGACTCG
GTATACGCTGCCTCTCTCAAGGTGCTCTCCGCGCAGCTGCCAGCTTCATTTCTGTCGATAGACGCGGGAACATTG
AATTCTCAGCACCCCCTGACAATTTTTCTCACGGGTGCTACTGGATTTCTAGGGGCGTATCTTATCCATGATTTG
TTAGGACGAGCAGGCCATCGGGTCTCCTTGATTGCTCACGTACGAAACGCCAAGGACTCAGAGGCTGCCAGGTCA
CGCCTGCAGCTCTCTTTGGAGGGCTATGGACTTTGGCATGACGAATGGTCAGATCGACTTACTTGCGTCGTTGGC
GACCTTACCAAGACGCGACTTGGCATGGACATGGACTCATGGAATCATGTGGCCAAGACTGCCGAAGTGGTGATA
CACAACGGAGCCACTGTTCACTGGGTAAAGCGTTATCAAGACTTATTGGCGGCTAATGTTATTTCAACCTTGGAT
GCTTTGCGGTTGTGTAACGAGGGCAAGCCAAAGACGTTCACATTTATCAGCTCGACGAGCGTCCTTGACACTGAT
TACTATATTCAACTATCTGAGAAGCAAGTTCACACCGGCCAGGGTGCTGTGTCCGAGGATGATGATATGATGGGG
AGCTGCAGTGGTTTAGGCACGGGCTACGGGCAGACTAAATGGGTATCGGAGCAACTAGTACGAGAAGCTGGCCGG
CGAGGACTTATTGGATCTGTGGTGCGCCCAGGGTATATATTGGGAGATACCAACAATGGCGTCTGCAACACGGAC
GACTTCTTGATACGACTGCTCAAGGGATGCGTCCAGCTTGGGATGCGGCCCCGAATCATCAACTCGGTCAACTCG
GTCCCTGTTAACCATGTGGCCCGTGTTGTTTCAGCGGCGGCACTTAACCCGATTGGCGAGGGAGTGTATGTTGTG
CATGTCACAGGCCATCCGCGGCTTCGCATGAATGAATACCTCTCGTTGCTCGAATATTATGGTTTCAAGGCGCGC
GAGGTTGGCTATAACGAGTGGAAAGATGAACTGGAGAAGTACGTCTTTGCTGGTGGACAAGATAAAGACCAGGAG
CAGCACGCACTGATGCCCCTCTATCATTTTTGCATCGACGACCTACCCGCAACCACGAGGGCACCTGAGCTTGAT
GACGAGAACGCGACTGGCCAACAGGCAATGGCCGGCCTTTACCGCATATTCAACTAG
Gene >OphauB2|5201
ATGGCTTGCTTGCCAGATCCGACGAGCGACCTAGACTGGTCCGGCTATGCTGGCTCTATACAATGGCACTTCAGC
GAGCAAGCCAAGATGAATCCGCATCGCCAATGCGTCATCGAAACCAAGTCTATAAATGCTCCTCAACGCTCCTTT
ACCTACAAGCAAATCTATCAGGCGTCGAACATCCTTGGTCACCATTTGCATCAGGCAGGAATTACGCATGGCGAC
GTCGTCATGATCTGGGCCCATAGGTCTGTGGACCTAGTAGTGGCTATTATGGGCACTCTTGTACGCATTTGCATT
GCATTTTGGCGAAGTCACAGGCTGACATGAATCTTCCGTCTAGGCCTCTGGCGCAACCATAAGCATTCTTGATCC
TCTCTACCCCCCAACTCGCCAGCAGATCTATCTCGAAGTCGCTCAACCTTGTGCACTCATAAATATCGCCCGCGC
CACTGACGAATCAGGGCCTCTTGCCCCTACCGTTCGGAGATATATCGATGAAGCACTGAATTTAAAAACCGAAGT
CCCTTTTCTTCGCCTCCAAGACGACGGATTCTTATCAAGCGGCCCTCTGGATGGGCACGACATTTTTGCCCATGT
AAGATCGAAGGCCGCCTCGAGCCCAGACATCATTGTCGGACCGGATAGCAACCCAACTCTTTCCTTCACCTCAGG
CAGTGAGGGACGGCCAAAGGGAGTCCTCGGGCGGCACTACAGTCTCACTAAGTACTTCTCGTGGATGTCTAAAAA
GTTCAATCTTAGCTCAAATAGCAAGTTCACTCTGCTCTCTGGTATTGCCCATGATCCAGTACAGAGAGATATCTT
CACACCTCTCTTTCTCGGAGCACAGCTTCTTGTTCCATCAGGAGAGGACATACAACACGAGAAGCTAGCGGAATG
GTTTAGAGAGTATAAGCCAACTGTCACTCATCTTACTCCCGCCATGGGCCAGATCCTTGTTGGTGGAGCTACAGC
CAGATTTCCCTGTCTAGACCGAGCTTTCTTTGTAGGTGACATCCTCACCACAAGAGACTGTAGGAGTTTGCGACG
CCTCGCGGTTAATTGCAACATTGTCAACATGTACGGAACCACGGAGACTCAGCGAGCCGTGAGTTACTACGAAAT
ACCTAGTTTGTCCCGAGAACCCGACTACCTGGACAAGCTCAAAGATACTGTTCCCGCCGGAAAGGGCATGGAAAA
CGTTCAACTTCTTGTAGTTGATCGGCAGTTTCTACGGAGGCTATGCGACATCGGAGAGATTGGGGAGATCTATGT
TCGAGCCGCTGGCCTCGCAGAAGGCTATAGAAACGACAAAGCTTTGAATGATGAAAGGTTTTTGAACAGCTGGTT
CGTCGACAATGACACCTGGGTGCAAGCAGATGCCAAATCGGCGAAAGGCGAACCCTGGAGAGCATATTTCAAGGG
ACCGCGTGACAGGCTGTATCGCACCGGCGACTTGGGACGCTATCTTGAGTCTGGCAATGTCGAGTGTACCGGACG
CGCCGATGACCAAGTTAAAATTCGAGGCTTTCGAATCGAGCTCAACGATATCGATAGTAATTTAAGTCAAAACCC
TCTGGTGAGAGATTGCAAGACACTTGTTCGGCGAGACAAGAACGAGGAGCCAACATTAGTGAGCTACGTCGTCCC
AGAACTCAATGAATGGCCCAAGTATTTGTCTGCCCGGGGACTGAACGATGTAGAAGATCAGGGAACAAGGATTGG
TCCAGCAACAGTCTACGTCAAACGCTTCCAGTGCATGCAGATCGAGCTGCGTGATAATCTCAAAGGTCGTTTACC
AAGTTACGCCATACCAACCACATTTATCTTTCTTGACAAGTTGCCTCTGAACCCGAATGGCAAGGTCGACAAGCC
CAACTTGCCATTCCCAGACATCGCAGAGCAAACAAAGGAGGCCTCCGGTGAAGAAGTCGAGCGATGGAGGACGAT
GACGGAAACAGAACGTATCGTGGCTACTAAATGGGCCGACTTAATTTCTGGTCTGAATCCCAAAACTATTGCTCC
GCAAGATAACTTCTTCGACCTTGGTGGGCATAGTCTATTGGCACAGCAGATGCTGCTTGTTATTCGCAAGGAACT
GGGTGCAAAAATTTCTATCAACACCCTCTATGAATTCCCGACCCTGGCGGGATTTAGTACACGAGTCGATCGACA
CTTAAGTCCGATATCGGATGAGATTGAAGAAATGAACCCAAAAGACGGCCAGGACTCGGTATACGCTGCCTCTCT
CAAGGTGCTCTCCGCGCAGCTGCCAGCTTCATTTCTGTCGATAGACGCGGGAACATTGAATTCTCAGCACCCCCT
GACAATTTTTCTCACGGGTGCTACTGGATTTCTAGGGGCGTATCTTATCCATGATTTGTTAGGACGAGCAGGCCA
TCGGGTCTCCTTGATTGCTCACGTACGAAACGCCAAGGACTCAGAGGCTGCCAGGTCACGCCTGCAGCTCTCTTT
GGAGGGCTATGGACTTTGGCATGACGAATGGTCAGATCGACTTACTTGCGTCGTTGGCGACCTTACCAAGACGCG
ACTTGGCATGGACATGGACTCATGGAATCATGTGGCCAAGACTGCCGAAGTGGTGATACACAACGGAGCCACTGT
TCACTGGGTAAAGCGTTATCAAGACTTATTGGCGGCTAATGTTATTTCAACCTTGGATGCTTTGCGGTTGTGTAA
CGAGGGCAAGCCAAAGACGTTCACATTTATCAGCTCGACGAGCGTCCTTGACACTGATTACTATATTCAACTATC
TGAGAAGCAAGTTCACACCGGCCAGGGTGCTGTGTCCGAGGATGATGATATGATGGGGAGCTGCAGTGGTTTAGG
CACGGGCTACGGGCAGACTAAATGGGTATCGGAGCAACTAGTACGAGAAGCTGGCCGGCGAGGACTTATTGGATC
TGTGGTGCGCCCAGGGTATATATTGGGAGATACCAACAATGGCGTCTGCAACACGGACGACTTCTTGATACGACT
GCTCAAGGGATGCGTCCAGCTTGGGATGCGGCCCCGAATCATCAACTCGGTCAACTCGGTCCCTGTTAACCATGT
GGCCCGTGTTGTTTCAGCGGCGGCACTTAACCCGATTGGCGAGGGAGTGTATGTTGTGCATGTCACAGGCCATCC
GCGGCTTCGCATGAATGAATACCTCTCGTTGCTCGAATATTATGGTTTCAAGGCGCGCGAGGTTGGCTATAACGA
GTGGAAAGATGAACTGGAGAAGTACGTCTTTGCTGGTGGACAAGATAAAGACCAGGAGCAGCACGCACTGATGCC
CCTCTATCATTTTTGCATCGACGACCTACCCGCAACCACGAGGGCACCTGAGCTTGATGACGAGAACGCGGTAAA
GGTTCTTAGGGCGGATGCGGAGAGATGGACCGGTGTTGATGAAAGTGCAGGCTATGGGGTGGGCAGAGAGGACGT
AGGCAGATATTTAAGATATCTTGCGGAAATTTGTTTTATAGACTGGCCAACAGGCAATGGCCGGCCTTTACCGCA
TATTCAACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail