Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5197
Gene name
LocationContig_39:129110..133381
Strand+
Gene length (bp)4271
Transcript length (bp)3975
Coding sequence length (bp)3975
Protein length (aa) 1325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 3.9E-82 994 1246
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 1.3E-26 197 263
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.6E-06 574 855
PF13246 Cation_ATPase Cation transport ATPase (P-type) 9.2E-10 656 744

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 194 1323 0.0E+00
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 92 1316 0.0E+00
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 195 1310 0.0E+00
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 195 1310 0.0E+00
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 195 1310 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 194 1323 0.0E+00
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 92 1316 0.0E+00
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 195 1310 0.0E+00
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 195 1310 0.0E+00
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 195 1310 0.0E+00
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 195 1312 0.0E+00
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 195 1312 0.0E+00
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 195 1312 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 182 1257 0.0E+00
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 169 1274 0.0E+00
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 178 1274 0.0E+00
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 187 1237 0.0E+00
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 181 1294 0.0E+00
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 186 1274 0.0E+00
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 193 1259 0.0E+00
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 170 1277 0.0E+00
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 162 1252 0.0E+00
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 182 1294 0.0E+00
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 166 1251 0.0E+00
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 193 1309 0.0E+00
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 170 1277 0.0E+00
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 195 1256 0.0E+00
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 208 1289 0.0E+00
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 208 1289 0.0E+00
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 208 1289 0.0E+00
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 195 1245 0.0E+00
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 209 1195 0.0E+00
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 200 1252 0.0E+00
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 208 1195 0.0E+00
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 195 1256 0.0E+00
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 195 1252 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 304 1270 0.0E+00
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 304 1264 0.0E+00
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 198 1252 0.0E+00
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 198 1319 0.0E+00
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 192 1231 0.0E+00
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 192 1231 0.0E+00
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 304 1253 0.0E+00
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 195 1256 7.0E-176
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 284 1246 1.0E-175
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 195 1127 3.0E-127
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 195 1252 5.0E-126
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 203 1251 4.0E-123
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 660 1242 8.0E-122
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 659 1245 8.0E-121
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 203 1251 1.0E-120
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 203 1251 1.0E-119
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 660 1301 1.0E-119
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 203 1248 2.0E-119
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 203 1251 9.0E-119
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 194 1251 8.0E-114
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 663 1231 1.0E-113
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 194 1251 7.0E-113
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 654 1231 3.0E-108
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 657 1271 2.0E-107
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 737 1267 6.0E-89
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 726 1286 5.0E-81
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 206 619 2.0E-78
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 212 619 6.0E-77
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 210 620 2.0E-76
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 210 620 6.0E-75
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 206 614 9.0E-73
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 311 748 1.0E-69
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 306 604 4.0E-50
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 549 1141 9.0E-28
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 549 1123 1.0E-25
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 549 1124 3.0E-24
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 549 1124 5.0E-24
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 549 1122 1.0E-23
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 549 1140 1.0E-23
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 507 1101 2.0E-23
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 507 1101 3.0E-23
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 507 1124 5.0E-23
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 507 1101 7.0E-23
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 507 1123 1.0E-22
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 507 1101 1.0E-22
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 507 1123 2.0E-22
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 507 1123 2.0E-22
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 549 1124 5.0E-22
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 549 1041 5.0E-21
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 507 1124 2.0E-20
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 507 1101 2.0E-20
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 549 1124 4.0E-20
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 507 1123 5.0E-20
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 507 1123 1.0E-19
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 507 1123 3.0E-19
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 506 1101 1.0E-18
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 558 1124 4.0E-18
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 507 1101 4.0E-18
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 558 1076 1.0E-17
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 702 1081 2.0E-15
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 702 1081 2.0E-15
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 641 780 4.0E-15
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 210 299 8.0E-15
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 314 1035 2.0E-14
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 558 1041 8.0E-14
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 558 1091 3.0E-13
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 560 994 3.0E-13
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 210 300 4.0E-13
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 289 1076 4.0E-13
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 558 1076 4.0E-13
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 314 1092 7.0E-13
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 558 1006 8.0E-13
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 700 1041 1.0E-12
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 711 994 2.0E-12
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 258 1099 2.0E-12
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 228 1092 2.0E-12
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 700 994 3.0E-12
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 258 1099 6.0E-12
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 560 1035 1.0E-11
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 291 1099 1.0E-11
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 258 1099 2.0E-11
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 558 1075 2.0E-11
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 502 1099 2.0E-11
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 258 1099 3.0E-11
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 566 1048 3.0E-11
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 566 1034 3.0E-11
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 711 1039 4.0E-11
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 700 1041 6.0E-11
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 295 1048 6.0E-11
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 295 1048 9.0E-11
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 570 985 1.0E-10
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 561 997 1.0E-10
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 238 1095 2.0E-10
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 210 301 3.0E-10
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 228 1048 8.0E-10
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 204 301 9.0E-10
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 696 994 1.0E-09
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 255 1048 2.0E-09
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 255 1048 2.0E-09
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 228 1048 2.0E-09
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 295 1048 2.0E-09
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 228 1048 2.0E-09
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 228 1048 2.0E-09
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 228 1048 3.0E-09
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 711 990 3.0E-09
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 711 990 6.0E-09
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 295 1048 8.0E-09
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 710 994 8.0E-09
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 295 1048 9.0E-09
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 210 317 1.0E-08
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 295 1048 1.0E-08
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 295 1048 2.0E-08
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 295 1048 2.0E-08
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 566 1048 4.0E-08
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 246 1048 7.0E-08
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 213 294 1.0E-07
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 295 1048 1.0E-07
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 246 1048 1.0E-07
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 246 1048 1.0E-07
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 246 1048 1.0E-07
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 566 1034 4.0E-07
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 566 1048 6.0E-07
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 812 1034 9.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 460 482 22
2 513 535 22
3 1026 1045 19
4 1065 1087 22
5 1107 1129 22
6 1144 1166 22
7 1173 1195 22
8 1217 1236 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5197
MAGRAARGVGGENLLLDLDGDQPVYSSGQRAALNKEHDLQTAGRASVSYDDFVGASAAHGGSTGPTGLGGGSYTN
SHYSQTSELGHYQRYADDEGDDESYYQHGGASGGQGPTSARNNARNRNSVLGLGGGLLGRVKNRLGMGEGYSEMD
LPLTESGQQRGASQAATQRRSKLELGNFKFGFGRSKPDASTLGPRIIHLNNPPANAANKYVDNHISTAKYNFATF
LPKFLVEQFSKFANIFFLFTAGLQQIPGLSPTNRYTTIAPLLIVLLISAGKEFVEDYRRKQADNALNTSKARVLR
GSSFAETKWINVGVGDVVRVESEEPFPADLVLLASSEPEGLCYIETANLDGETNLKIKQALPETSSMVSSSELSR
LGGRIKSEQPNSSLYTYEATLTMQAGGGEKEVALNPEQLLLRGATLRNTPWIHGVVVFSGHETKLMRNATAAPIK
RTKVERQLNWLVLVLVGMLLALSVVCTVGDLVMRSVRGDSFDYLYLERIDSAAKVAQTFAKDMVTYWVLFSSLVP
ISLFVTVELVKYWHGILINDDLDMYHDKTDTPATCRTSSLVEELGMVEYVFSDKTGTLTCNQMEFKQCTIAGLQY
AAEVPEERRETVTEESAVLDFARLRANLAEGHETAGAIDHFLTLLSICHTVIPEMTEKGHIKYQAASPDEGALVA
GAVDLGYRFTARKPKSVIIHANGRPLEYELLAVCEFNSTRKRMSAIYRCPDGKIRCYCKGADTVILERLGADNGH
VDATLRHLEEYASEGLRTLCLAMRQIPEQEFSEWMRIYEAASTTVGGTRADELDKASDIIEHGFYLLGATAIEDR
LQDGVPETIHTLQQANIKVWVLTGDRQETAINIGMSCKLLSEDMMLLIVNEETLPATRDNMHKKLEAIRTQGDGN
IEMEALALIIDGKSLTFALEADLEKLFLDLAVVCKAVICCRVSPLQKALVVKLVKKYQKQSILLAIGDGANDVSM
IQAAHIGVGISGMEGLQAARSADVAIAQFRYLRKLLLVHGAWSYQRVSKTILFSFYKNIALYMTQFWYTFQNVFS
GQVIYESWTLSFYNVFYTVLPPLALGILDQFISARLLDRYPQLYMMGQKNYFFKLKVFAQWIANAFYHSIILYIW
SELIWYDDLIQGDGKTAGHWVWGTALYGAVLLTVIGKAALVTNNWTKYHVLAIPGSMAIWYVFVAAYGSLAPLAN
FSTEYRGVVPRLYTSPVFWLQTVVLAMMCLLRDFAWKFAKRMYWPQTYHHIQEIQKYNIQDYRPRMEQFQKAIRK
VRQVQRMRKQRGYAFSQADESQTRVLQAYDTTKHRGRYGEMASSRPLGR*
Coding >OphauB2|5197
ATGGCTGGGAGGGCGGCGAGAGGTGTGGGCGGCGAGAACCTGCTCCTGGACCTGGATGGCGACCAGCCCGTGTAC
AGCAGCGGGCAACGGGCGGCTCTAAACAAGGAGCATGATTTACAGACAGCAGGCCGGGCGTCGGTATCATACGAC
GACTTTGTCGGGGCTTCAGCTGCCCATGGTGGCTCGACTGGGCCGACTGGGCTGGGGGGTGGGTCGTACACAAAC
AGCCACTACAGCCAGACATCAGAGCTGGGCCACTACCAGCGGTATGCCGACGACGAGGGCGACGACGAGTCATAC
TACCAGCACGGTGGAGCAAGTGGCGGGCAGGGCCCAACGTCGGCGAGGAACAATGCGAGAAATAGAAACAGCGTG
CTTGGGCTGGGGGGCGGCCTCTTGGGCAGGGTCAAGAACCGACTTGGAATGGGCGAGGGCTATTCCGAGATGGAC
CTGCCCTTGACCGAGTCTGGCCAGCAGCGAGGCGCATCGCAGGCGGCGACGCAGCGGCGGTCCAAGCTGGAGCTG
GGCAACTTCAAGTTTGGCTTTGGGCGAAGCAAGCCGGATGCGTCGACGCTGGGCCCGCGCATCATCCATCTCAAC
AACCCTCCGGCCAATGCGGCCAACAAGTATGTGGACAACCACATTTCGACGGCAAAGTACAACTTTGCCACGTTT
CTGCCCAAGTTTCTGGTGGAGCAGTTTTCCAAGTTTGCAAACATATTTTTCCTCTTCACAGCGGGCCTGCAGCAG
ATCCCGGGGCTCTCGCCGACGAACCGCTACACGACGATTGCGCCGCTGCTCATTGTGCTGCTCATCTCGGCGGGC
AAGGAGTTTGTGGAGGACTACCGGCGCAAGCAGGCGGACAATGCGCTCAACACGTCCAAGGCGCGCGTGTTGCGG
GGGAGCAGCTTTGCCGAGACCAAGTGGATCAATGTGGGCGTGGGAGACGTGGTGCGGGTCGAGTCGGAGGAGCCC
TTTCCGGCGGACCTGGTGCTGCTGGCAAGTTCGGAGCCCGAGGGACTCTGTTATATCGAAACAGCGAATCTGGAT
GGCGAGACCAACTTGAAGATTAAGCAGGCGCTGCCCGAGACGTCGTCGATGGTGTCGTCGAGCGAGCTGAGCCGG
CTGGGGGGGCGCATCAAGTCGGAGCAGCCAAACAGCAGCCTGTACACGTATGAGGCGACGCTGACGATGCAGGCG
GGCGGGGGCGAGAAGGAAGTGGCTCTCAACCCGGAGCAGCTGCTGCTACGGGGAGCGACGCTGCGCAACACGCCG
TGGATCCACGGCGTCGTCGTCTTTAGCGGGCACGAGACCAAGCTGATGCGCAATGCCACGGCCGCCCCAATCAAG
CGGACCAAGGTGGAGAGGCAGCTCAACTGGCTGGTGCTGGTGCTGGTGGGGATGCTGCTGGCGCTGAGCGTGGTG
TGCACGGTGGGCGACTTGGTGATGCGCAGCGTGCGCGGCGACTCGTTTGACTATCTCTACCTGGAGCGCATCGAC
AGCGCGGCCAAGGTGGCGCAGACGTTTGCCAAGGACATGGTGACGTACTGGGTGCTCTTCTCGTCGCTGGTGCCC
ATTTCGCTCTTTGTGACGGTGGAGCTGGTCAAGTACTGGCACGGCATCCTCATCAACGACGACCTCGACATGTAC
CACGACAAGACGGACACGCCGGCCACGTGCCGCACCTCGAGCCTGGTTGAGGAGCTGGGCATGGTGGAGTATGTC
TTTTCCGACAAGACGGGCACGCTGACGTGCAACCAGATGGAGTTTAAGCAGTGCACCATTGCCGGCCTGCAGTAT
GCGGCCGAGGTGCCCGAGGAGCGCCGCGAGACGGTGACGGAGGAGAGCGCGGTGCTCGACTTTGCCAGGCTGCGG
GCCAACCTGGCCGAGGGCCACGAGACGGCGGGGGCCATTGACCACTTCCTGACGCTGCTGTCGATATGCCACACG
GTGATTCCCGAAATGACGGAAAAGGGCCACATCAAGTACCAGGCGGCGTCGCCCGACGAAGGCGCCCTGGTGGCG
GGCGCTGTGGACCTGGGCTACCGCTTCACGGCGCGCAAGCCCAAGTCGGTCATTATCCATGCCAACGGGCGCCCC
CTCGAGTACGAGCTGCTGGCCGTGTGCGAGTTCAACTCGACGCGCAAGCGCATGTCGGCCATTTACCGCTGTCCC
GACGGCAAGATTCGCTGCTACTGCAAGGGCGCCGACACGGTGATTCTGGAGCGCCTCGGAGCCGACAATGGCCAC
GTCGACGCCACCCTGCGCCACCTGGAGGAGTACGCGTCCGAGGGCCTGCGCACCCTGTGTCTGGCCATGCGCCAA
ATCCCCGAGCAAGAGTTTAGCGAGTGGATGCGCATCTACGAGGCCGCCTCAACCACGGTGGGCGGCACCCGCGCC
GACGAGCTGGACAAGGCCTCGGACATTATCGAGCACGGCTTCTACCTGCTCGGCGCCACCGCCATTGAGGACCGC
CTGCAAGACGGCGTCCCCGAGACCATCCACACCCTGCAGCAGGCCAACATCAAGGTGTGGGTCCTGACGGGCGAC
CGCCAGGAGACGGCCATCAACATTGGCATGAGCTGCAAGCTGCTGAGCGAGGACATGATGCTGCTCATTGTCAAT
GAGGAGACGCTGCCCGCCACCCGCGACAACATGCACAAGAAGCTCGAGGCCATTCGCACCCAGGGCGACGGCAAC
ATTGAGATGGAGGCCCTGGCCCTCATTATTGACGGCAAGTCGCTGACCTTTGCCCTCGAGGCCGACCTGGAGAAG
CTCTTTTTGGACCTGGCCGTCGTGTGCAAGGCCGTCATTTGCTGCCGCGTCTCGCCCCTGCAAAAGGCCCTCGTC
GTCAAGCTGGTCAAGAAGTACCAGAAGCAGTCCATCCTGCTGGCCATTGGCGACGGCGCCAACGACGTGTCCATG
ATTCAGGCCGCCCACATTGGCGTCGGCATCAGCGGCATGGAGGGCCTGCAGGCCGCCCGCAGTGCCGACGTGGCC
ATTGCCCAGTTCCGCTATCTGCGCAAGCTGCTGCTGGTGCACGGCGCCTGGAGCTACCAGCGCGTCAGCAAGACG
ATTCTCTTTTCCTTTTACAAGAATATTGCCCTCTACATGACGCAGTTTTGGTACACCTTTCAAAACGTCTTTTCC
GGCCAAGTCATTTACGAGTCGTGGACCCTCTCCTTTTACAACGTCTTCTACACCGTGCTGCCGCCCCTGGCCCTC
GGCATCCTCGACCAGTTCATCTCGGCGCGCCTGCTCGACCGCTACCCCCAGCTGTACATGATGGGCCAGAAGAAC
TACTTCTTCAAGCTCAAGGTGTTTGCCCAGTGGATCGCCAATGCCTTTTACCACTCCATCATCCTCTACATCTGG
TCCGAGCTCATTTGGTACGACGATTTGATTCAGGGCGACGGCAAGACGGCCGGCCACTGGGTCTGGGGCACCGCC
CTCTATGGCGCCGTCCTTTTGACCGTGATTGGCAAGGCGGCCCTCGTCACCAACAACTGGACCAAGTACCACGTC
CTGGCCATTCCCGGCAGCATGGCCATTTGGTATGTCTTTGTCGCCGCCTATGGCTCCCTTGCGCCCCTCGCCAAC
TTTTCCACCGAGTACCGCGGCGTCGTCCCGCGCCTCTACACGAGCCCCGTCTTTTGGCTGCAGACTGTCGTGCTG
GCCATGATGTGTCTGCTGCGCGACTTTGCCTGGAAGTTTGCCAAGCGCATGTACTGGCCCCAGACTTATCACCAC
ATTCAAGAGATTCAAAAGTATAACATTCAAGACTATCGGCCTAGAATGGAGCAGTTCCAAAAGGCCATTCGCAAG
GTGCGCCAGGTCCAGCGCATGAGGAAGCAGCGTGGCTATGCCTTTTCGCAGGCCGACGAGAGCCAGACACGCGTG
CTTCAGGCCTACGACACCACCAAGCATCGCGGCCGTTACGGAGAGATGGCGAGTTCGAGGCCGCTGGGGCGGTAG
Transcript >OphauB2|5197
ATGGCTGGGAGGGCGGCGAGAGGTGTGGGCGGCGAGAACCTGCTCCTGGACCTGGATGGCGACCAGCCCGTGTAC
AGCAGCGGGCAACGGGCGGCTCTAAACAAGGAGCATGATTTACAGACAGCAGGCCGGGCGTCGGTATCATACGAC
GACTTTGTCGGGGCTTCAGCTGCCCATGGTGGCTCGACTGGGCCGACTGGGCTGGGGGGTGGGTCGTACACAAAC
AGCCACTACAGCCAGACATCAGAGCTGGGCCACTACCAGCGGTATGCCGACGACGAGGGCGACGACGAGTCATAC
TACCAGCACGGTGGAGCAAGTGGCGGGCAGGGCCCAACGTCGGCGAGGAACAATGCGAGAAATAGAAACAGCGTG
CTTGGGCTGGGGGGCGGCCTCTTGGGCAGGGTCAAGAACCGACTTGGAATGGGCGAGGGCTATTCCGAGATGGAC
CTGCCCTTGACCGAGTCTGGCCAGCAGCGAGGCGCATCGCAGGCGGCGACGCAGCGGCGGTCCAAGCTGGAGCTG
GGCAACTTCAAGTTTGGCTTTGGGCGAAGCAAGCCGGATGCGTCGACGCTGGGCCCGCGCATCATCCATCTCAAC
AACCCTCCGGCCAATGCGGCCAACAAGTATGTGGACAACCACATTTCGACGGCAAAGTACAACTTTGCCACGTTT
CTGCCCAAGTTTCTGGTGGAGCAGTTTTCCAAGTTTGCAAACATATTTTTCCTCTTCACAGCGGGCCTGCAGCAG
ATCCCGGGGCTCTCGCCGACGAACCGCTACACGACGATTGCGCCGCTGCTCATTGTGCTGCTCATCTCGGCGGGC
AAGGAGTTTGTGGAGGACTACCGGCGCAAGCAGGCGGACAATGCGCTCAACACGTCCAAGGCGCGCGTGTTGCGG
GGGAGCAGCTTTGCCGAGACCAAGTGGATCAATGTGGGCGTGGGAGACGTGGTGCGGGTCGAGTCGGAGGAGCCC
TTTCCGGCGGACCTGGTGCTGCTGGCAAGTTCGGAGCCCGAGGGACTCTGTTATATCGAAACAGCGAATCTGGAT
GGCGAGACCAACTTGAAGATTAAGCAGGCGCTGCCCGAGACGTCGTCGATGGTGTCGTCGAGCGAGCTGAGCCGG
CTGGGGGGGCGCATCAAGTCGGAGCAGCCAAACAGCAGCCTGTACACGTATGAGGCGACGCTGACGATGCAGGCG
GGCGGGGGCGAGAAGGAAGTGGCTCTCAACCCGGAGCAGCTGCTGCTACGGGGAGCGACGCTGCGCAACACGCCG
TGGATCCACGGCGTCGTCGTCTTTAGCGGGCACGAGACCAAGCTGATGCGCAATGCCACGGCCGCCCCAATCAAG
CGGACCAAGGTGGAGAGGCAGCTCAACTGGCTGGTGCTGGTGCTGGTGGGGATGCTGCTGGCGCTGAGCGTGGTG
TGCACGGTGGGCGACTTGGTGATGCGCAGCGTGCGCGGCGACTCGTTTGACTATCTCTACCTGGAGCGCATCGAC
AGCGCGGCCAAGGTGGCGCAGACGTTTGCCAAGGACATGGTGACGTACTGGGTGCTCTTCTCGTCGCTGGTGCCC
ATTTCGCTCTTTGTGACGGTGGAGCTGGTCAAGTACTGGCACGGCATCCTCATCAACGACGACCTCGACATGTAC
CACGACAAGACGGACACGCCGGCCACGTGCCGCACCTCGAGCCTGGTTGAGGAGCTGGGCATGGTGGAGTATGTC
TTTTCCGACAAGACGGGCACGCTGACGTGCAACCAGATGGAGTTTAAGCAGTGCACCATTGCCGGCCTGCAGTAT
GCGGCCGAGGTGCCCGAGGAGCGCCGCGAGACGGTGACGGAGGAGAGCGCGGTGCTCGACTTTGCCAGGCTGCGG
GCCAACCTGGCCGAGGGCCACGAGACGGCGGGGGCCATTGACCACTTCCTGACGCTGCTGTCGATATGCCACACG
GTGATTCCCGAAATGACGGAAAAGGGCCACATCAAGTACCAGGCGGCGTCGCCCGACGAAGGCGCCCTGGTGGCG
GGCGCTGTGGACCTGGGCTACCGCTTCACGGCGCGCAAGCCCAAGTCGGTCATTATCCATGCCAACGGGCGCCCC
CTCGAGTACGAGCTGCTGGCCGTGTGCGAGTTCAACTCGACGCGCAAGCGCATGTCGGCCATTTACCGCTGTCCC
GACGGCAAGATTCGCTGCTACTGCAAGGGCGCCGACACGGTGATTCTGGAGCGCCTCGGAGCCGACAATGGCCAC
GTCGACGCCACCCTGCGCCACCTGGAGGAGTACGCGTCCGAGGGCCTGCGCACCCTGTGTCTGGCCATGCGCCAA
ATCCCCGAGCAAGAGTTTAGCGAGTGGATGCGCATCTACGAGGCCGCCTCAACCACGGTGGGCGGCACCCGCGCC
GACGAGCTGGACAAGGCCTCGGACATTATCGAGCACGGCTTCTACCTGCTCGGCGCCACCGCCATTGAGGACCGC
CTGCAAGACGGCGTCCCCGAGACCATCCACACCCTGCAGCAGGCCAACATCAAGGTGTGGGTCCTGACGGGCGAC
CGCCAGGAGACGGCCATCAACATTGGCATGAGCTGCAAGCTGCTGAGCGAGGACATGATGCTGCTCATTGTCAAT
GAGGAGACGCTGCCCGCCACCCGCGACAACATGCACAAGAAGCTCGAGGCCATTCGCACCCAGGGCGACGGCAAC
ATTGAGATGGAGGCCCTGGCCCTCATTATTGACGGCAAGTCGCTGACCTTTGCCCTCGAGGCCGACCTGGAGAAG
CTCTTTTTGGACCTGGCCGTCGTGTGCAAGGCCGTCATTTGCTGCCGCGTCTCGCCCCTGCAAAAGGCCCTCGTC
GTCAAGCTGGTCAAGAAGTACCAGAAGCAGTCCATCCTGCTGGCCATTGGCGACGGCGCCAACGACGTGTCCATG
ATTCAGGCCGCCCACATTGGCGTCGGCATCAGCGGCATGGAGGGCCTGCAGGCCGCCCGCAGTGCCGACGTGGCC
ATTGCCCAGTTCCGCTATCTGCGCAAGCTGCTGCTGGTGCACGGCGCCTGGAGCTACCAGCGCGTCAGCAAGACG
ATTCTCTTTTCCTTTTACAAGAATATTGCCCTCTACATGACGCAGTTTTGGTACACCTTTCAAAACGTCTTTTCC
GGCCAAGTCATTTACGAGTCGTGGACCCTCTCCTTTTACAACGTCTTCTACACCGTGCTGCCGCCCCTGGCCCTC
GGCATCCTCGACCAGTTCATCTCGGCGCGCCTGCTCGACCGCTACCCCCAGCTGTACATGATGGGCCAGAAGAAC
TACTTCTTCAAGCTCAAGGTGTTTGCCCAGTGGATCGCCAATGCCTTTTACCACTCCATCATCCTCTACATCTGG
TCCGAGCTCATTTGGTACGACGATTTGATTCAGGGCGACGGCAAGACGGCCGGCCACTGGGTCTGGGGCACCGCC
CTCTATGGCGCCGTCCTTTTGACCGTGATTGGCAAGGCGGCCCTCGTCACCAACAACTGGACCAAGTACCACGTC
CTGGCCATTCCCGGCAGCATGGCCATTTGGTATGTCTTTGTCGCCGCCTATGGCTCCCTTGCGCCCCTCGCCAAC
TTTTCCACCGAGTACCGCGGCGTCGTCCCGCGCCTCTACACGAGCCCCGTCTTTTGGCTGCAGACTGTCGTGCTG
GCCATGATGTGTCTGCTGCGCGACTTTGCCTGGAAGTTTGCCAAGCGCATGTACTGGCCCCAGACTTATCACCAC
ATTCAAGAGATTCAAAAGTATAACATTCAAGACTATCGGCCTAGAATGGAGCAGTTCCAAAAGGCCATTCGCAAG
GTGCGCCAGGTCCAGCGCATGAGGAAGCAGCGTGGCTATGCCTTTTCGCAGGCCGACGAGAGCCAGACACGCGTG
CTTCAGGCCTACGACACCACCAAGCATCGCGGCCGTTACGGAGAGATGGCGAGTTCGAGGCCGCTGGGGCGGTAG
Gene >OphauB2|5197
ATGGCTGGGAGGGCGGCGAGAGGTGTGGGCGGCGAGAACCTGCTCCTGGACCTGGATGGCGACCAGCCCGTGTAC
AGCAGCGGGCAACGGGCGGCTCTAAACAAGGAGCATGATTTACAGACAGCAGGCCGGGCGTCGGTATCATACGAC
GACTTTGTCGGGGCTTCAGCTGCCCATGGTGGCTCGACTGGGCCGACTGGGCTGGGGGGTGGGTCGTACACAAAC
AGCCACTACAGCCAGACATCAGAGCTGGGCCACTACCAGCGGTATGCCGACGACGAGGGCGACGACGAGTCATAC
TACCAGCACGGTGGAGCAAGTGGCGGGCAGGGCCCAACGTCGGCGAGGAACAATGCGAGAAATAGAAACAGCGTG
CTTGGGCTGGGGGGCGGCCTCTTGGGCAGGGTCAAGAACCGACTTGGAATGGGCGAGGGCTATTCCGAGATGGAC
CTGCCCTTGACCGAGTCTGGCCAGCAGCGAGGCGCATCGCAGGCGGCGACGCAGCGGCGGTCCAAGCTGGAGCTG
GGCAACTTCAAGTTTGGCTTTGGGCGAAGCAAGCCGGATGCGTCGACGCTGGGCCCGCGCATCATCCATCTCAAC
AACCCTCCGGCCAATGCGGCCAACAAGTATGTGGACAACCACATTTCGACGGCAAAGTACAACTTTGCCACGTTT
CTGCCCAAGTTTCTGGTGGAGCAGTTTTCCAAGTTTGCAAACATATTTTTCCTCTTCACAGCGGGCCTGCAGCAG
ATCCCGGGGCTCTCGCCGACGAACCGCTACACGACGATTGCGCCGCTGCTCATTGTGCTGCTCATCTCGGCGGGC
AAGGAGTTTGTGGAGGACTACCGGCGCAAGCAGGCGGACAATGCGCTCAACACGTCCAAGGCGCGCGTGTTGCGG
GGGAGCAGCTTTGCCGAGACCAAGTGGATCAATGTGGGCGTGGGAGACGTGGTGCGGGTCGAGTCGGAGGAGCCC
TTTCCGGCGGACCTGGTGCTGCTGGCAAGTTCGGAGCCCGAGGGACTCTGTTATATCGAAACAGCGAATCTGGAT
GGCGAGACCAACTTGAAGATTAAGCAGGCGCTGCCCGAGACGTCGTCGATGGTGTCGTCGAGCGAGCTGAGCCGG
CTGGGGGGGCGCATCAAGTCGGAGCAGCCAAACAGCAGCCTGTACACGTATGAGGCGACGCTGACGATGCAGGCG
GGCGGGGGCGAGAAGGAAGTGGCTCTCAACCCGGAGCAGCTGCTGCTACGGGGAGCGACGCTGCGCAACACGCCG
TGGATCCACGGCGTCGTCGTCTTTAGCGGGCACGAGACCAAGCTGATGCGCAATGCCACGGCCGCCCCAATCAAG
CGGACCAAGGTGGAGAGGCAGCTCAACTGGCTGGTGCTGGTGCTGGTGGGGATGCTGCTGGCGCTGAGCGTGGTG
TGCACGGTGGGCGACTTGGTGATGCGCAGCGTGCGCGGCGACTCGTTTGACTATCTCTACCTGGAGCGCATCGAC
AGCGCGGCCAAGGTGGCGCAGACGTTTGCCAAGGACATGGTGACGTACTGGGTGCTCTTCTCGTCGCTGGTGCCC
ATTTCGCTCTTTGTGACGGTGGAGCTGGTCAAGTACTGGCACGGCATCCTCATCAACGACGACCTCGACATGTAC
CACGACAAGACGGACACGCCGGCCACGTGCCGCACCTCGAGCCTGGTTGAGGAGCTGGGCATGGTGGAGTATGTC
TTTTCCGACAAGACGGGCACGCTGACGTGCAACCAGATGGAGTTTAAGCAGTGCACCATTGCCGGCCTGCAGTAT
GCGGCCGAGGTGCCCGAGGAGCGCCGCGAGACGGTGACGGAGGAGAGCGCGGTGCTCGACTTTGCCAGGCTGCGG
GCCAACCTGGCCGAGGGCCACGAGACGGCGGGGGCCATTGACCACTTCCTGACGCTGCTGTCGATATGCCACACG
GTGATTCCCGAAATGACGGAAAAGGGCCACATCAAGTACCAGGCGGCGTCGCCCGACGAAGGCGCCCTGGTGGCG
GGCGCTGTGGACCTGGGCTACCGCTTCACGGCGCGCAAGCCCAAGTCGGTCATTATCCATGCCAACGGGCGCCCC
CTCGAGTACGAGCTGCTGGCCGTGTGCGAGTTCAACTCGACGCGCAAGCGCATGTCGGCCATTTACCGCTGTCCC
GACGGCAAGATTCGCTGCTACTGCAAGGGCGCCGACACGGTGATTCTGGAGCGCCTCGGAGCCGACAATGGCCAC
GTCGACGCCACCCTGCGCCACCTGGAGGAGTACGCGTCCGAGGGCCTGCGCACCCTGTGTCTGGCCATGCGCCAA
ATCCCCGAGCAAGAGTTTAGCGAGTGGATGCGCATCTACGAGGCCGCCTCAACCACGGTGGGCGGCACCCGCGCC
GACGAGCTGGACAAGGCCTCGGACATTATCGAGCACGGCTTCTACCTGCTCGGCGCCACCGCCATTGAGGACCGC
CTGCAAGACGGCGTCCCCGAGACCATCCACACCCTGCAGCAGGCCAACATCAAGGTGTGGGTCCTGACGGGCGAC
CGCCAGGAGACGGCCATCAACATTGGCATGAGCTGCAAGCTGCTGAGCGAGGACATGATGCTGCTCATTGTCAAT
GAGGAGACGCTGCCCGCCACCCGCGACAACATGCACAAGAAGCTCGAGGCCATTCGCACCCAGGGCGACGGCAAC
ATTGAGATGGAGGCCCTGGCCCTCATTATTGACGGCAAGTCGCTGACCTTTGCCCTCGAGGCCGACCTGGAGAAG
CTCTTTTTGGACCTGGCCGTCGTGTGCAAGGCCGTCATTTGCTGCCGCGTCTCGCCCCTGCAAAAGGCCCTCGTC
GTCAAGCTGGTCAAGAAGTACCAGAAGCAGTCCATCCTGCTGGCCATTGGCGACGGCGCCAACGACGTGTCCATG
ATTCAGGCCGCCCACATTGGCGTCGGCATCAGCGGCATGGAGGGCCTGCAGGCCGCCCGCAGTGCCGACGTGGCC
ATTGCCCAGTTCCGCTATCTGCGCAAGCTGCTGCTGGTGCACGGCGCCTGGAGCTACCAGCGCGTCAGCAAGACG
ATTCTCTTTTCCTTTTACAAGAATATTGCCCTCTACATGACGCAGTTTTGGGTGAGGCCGCCCTCCTTGTCCAGC
CNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCC
TCTCTGTCCCTTTTTTCCCCTTTTGCCCCCTTTTCCCCTTTTGCCCCCTTTTCCCCTTCTGTCCTACTTCTCCCC
TACTTCTCCTCTGGTGCCATGGCTAACACCCTCCCAGTACACCTTTCAAAACGTCTTTTCCGGCCAAGTCATTTA
CGAGTCGTGGACCCTCTCCTTTTACAACGTCTTCTACACCGTGCTGCCGCCCCTGGCCCTCGGCATCCTCGACCA
GTTCATCTCGGCGCGCCTGCTCGACCGCTACCCCCAGCTGTACATGATGGGCCAGAAGAACTACTTCTTCAAGCT
CAAGGTGTTTGCCCAGTGGATCGCCAATGCCTTTTACCACTCCATCATCCTCTACATCTGGTCCGAGCTCATTTG
GTACGACGATTTGATTCAGGGCGACGGCAAGACGGCCGGCCACTGGGTCTGGGGCACCGCCCTCTATGGCGCCGT
CCTTTTGACCGTGATTGGCAAGGCGGCCCTCGTCACCAACAACTGGACCAAGTACCACGTCCTGGCCATTCCCGG
CAGCATGGCCATTTGGTATGTCTTTGTCGCCGCCTATGGCTCCCTTGCGCCCCTCGCCAACTTTTCCACCGAGTA
CCGCGGCGTCGTCCCGCGCCTCTACACGAGCCCCGTCTTTTGGCTGCAGACTGTCGTGCTGGCCATGATGTGTCT
GCTGCGCGACTTTGCCTGGAAGTTTGCCAAGCGCATGTACTGGCCCCAGACTTATCACCACATTCAAGAGATTCA
AAAGTATAACATTCAAGACTATCGGCCTAGGTGAGCCATTCCTCTCTCTCTCTTTGCCTCGATGCGCCTACGCTC
TGGACGCTTTATGTTGACTTTTTTTTTTTTTTCCCAAAAGAATGGAGCAGTTCCAAAAGGCCATTCGCAAGGTGC
GCCAGGTCCAGCGCATGAGGAAGCAGCGTGGCTATGCCTTTTCGCAGGCCGACGAGAGCCAGACACGCGTGCTTC
AGGCCTACGACACCACCAAGCATCGCGGCCGTTACGGAGAGATGGCGAGTTCGAGGCCGCTGGGGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail