Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5182
Gene name
LocationContig_39:92904..94854
Strand+
Gene length (bp)1950
Transcript length (bp)1854
Coding sequence length (bp)1854
Protein length (aa) 618

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00628 PHD PHD-finger 4.6E-10 132 175
PF13639 zf-RING_2 Ring finger domain 2.0E-07 51 79
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.0E-06 7 78

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94400|YQF7_SCHPO PHD and RING finger domain-containing protein C126.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.07c PE=3 SV=1 5 615 4.0E-26
sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 35 175 7.0E-18
sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 41 174 3.0E-17
sp|Q63625|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2 41 175 3.0E-15
sp|Q80Y84|KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus GN=Kdm5b PE=1 SV=1 132 186 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94400|YQF7_SCHPO PHD and RING finger domain-containing protein C126.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.07c PE=3 SV=1 5 615 4.0E-26
sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 35 175 7.0E-18
sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 41 174 3.0E-17
sp|Q63625|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2 41 175 3.0E-15
sp|Q80Y84|KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus GN=Kdm5b PE=1 SV=1 132 186 5.0E-10
sp|Q5F3R2|KDM5B_CHICK Lysine-specific demethylase 5B OS=Gallus gallus GN=KDM5B PE=2 SV=1 132 186 6.0E-10
sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 132 259 1.0E-09
sp|Q9UGL1|KDM5B_HUMAN Lysine-specific demethylase 5B OS=Homo sapiens GN=KDM5B PE=1 SV=3 132 174 1.0E-09
sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 132 174 2.0E-08
sp|C4QVX6|ATG35_PICPG Autophagy-related protein 36 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ATG35 PE=1 SV=1 46 197 3.0E-08
sp|Q3UXZ9|KDM5A_MOUSE Lysine-specific demethylase 5A OS=Mus musculus GN=Kdm5a PE=1 SV=2 132 186 3.0E-08
sp|P29375|KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens GN=KDM5A PE=1 SV=3 132 175 4.0E-08
sp|Q9SGH2|MBD9_ARATH Methyl-CpG-binding domain-containing protein 9 OS=Arabidopsis thaliana GN=MBD9 PE=2 SV=1 132 175 6.0E-08
sp|Q6IQX0|KD5BB_DANRE Lysine-specific demethylase 5B-B OS=Danio rerio GN=kdm5bb PE=2 SV=2 132 174 6.0E-08
sp|Q9VMJ7|KDM5_DROME Lysine-specific demethylase lid OS=Drosophila melanogaster GN=lid PE=1 SV=1 132 175 9.0E-08
sp|Q5PNS0|Y3228_ARATH PHD finger protein At3g20280 OS=Arabidopsis thaliana GN=At3g20280 PE=2 SV=1 100 180 1.0E-07
sp|Q9HDV4|LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lid2 PE=1 SV=1 132 182 3.0E-07
sp|Q9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens GN=BAZ2A PE=1 SV=4 124 174 3.0E-07
sp|Q91YE5|BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus GN=Baz2a PE=1 SV=2 124 174 3.0E-07
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 132 174 4.0E-07
sp|B7ZS37|BAZ2A_XENLA Bromodomain adjacent to zinc finger domain protein 2A OS=Xenopus laevis GN=baz2a PE=2 SV=1 124 190 4.0E-07
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 132 174 5.0E-07
sp|Q9VWF2|SAYP_DROME Supporter of activation of yellow protein OS=Drosophila melanogaster GN=e(y)3 PE=2 SV=3 132 174 5.0E-07
sp|Q2T9V9|PHF10_BOVIN PHD finger protein 10 OS=Bos taurus GN=PHF10 PE=2 SV=1 132 177 1.0E-06
sp|Q8WUB8|PHF10_HUMAN PHD finger protein 10 OS=Homo sapiens GN=PHF10 PE=1 SV=3 132 177 1.0E-06
sp|Q4V7A6|PHF10_RAT PHD finger protein 10 OS=Rattus norvegicus GN=Phf10 PE=1 SV=2 132 177 2.0E-06
sp|Q9D8M7|PHF10_MOUSE PHD finger protein 10 OS=Mus musculus GN=Phf10 PE=1 SV=4 132 177 2.0E-06
sp|Q63ZP1|PHF10_XENLA PHD finger protein 10 OS=Xenopus laevis GN=phf10 PE=2 SV=2 132 181 3.0E-06
sp|Q9Z277|BAZ1B_MOUSE Tyrosine-protein kinase BAZ1B OS=Mus musculus GN=Baz1b PE=1 SV=2 132 174 4.0E-06
sp|Q6NWE1|PHF10_DANRE PHD finger protein 10 OS=Danio rerio GN=phf10 PE=2 SV=2 132 175 4.0E-06
sp|Q96T23|RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens GN=RSF1 PE=1 SV=2 131 178 4.0E-06
sp|Q9UIG0|BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens GN=BAZ1B PE=1 SV=2 132 174 4.0E-06
sp|Q92785|REQU_HUMAN Zinc finger protein ubi-d4 OS=Homo sapiens GN=DPF2 PE=1 SV=2 132 178 5.0E-06
sp|Q30DN6|KDM5D_CANLF Lysine-specific demethylase 5D OS=Canis lupus familiaris GN=KDM5D PE=2 SV=1 132 174 6.0E-06
sp|P58268|REQU_CHICK Zinc finger protein ubi-d4 OS=Gallus gallus GN=REQ PE=2 SV=1 132 176 7.0E-06
sp|Q9W636|REQUB_XENLA Zinc finger protein ubi-d4 B (Fragment) OS=Xenopus laevis GN=req-b PE=2 SV=2 132 176 7.0E-06
sp|Q61103|REQU_MOUSE Zinc finger protein ubi-d4 OS=Mus musculus GN=Dpf2 PE=1 SV=1 132 176 8.0E-06
sp|P41229|KDM5C_HUMAN Lysine-specific demethylase 5C OS=Homo sapiens GN=KDM5C PE=1 SV=2 129 175 8.0E-06
sp|P41230|KDM5C_MOUSE Lysine-specific demethylase 5C OS=Mus musculus GN=Kdm5c PE=1 SV=4 129 175 8.0E-06
sp|Q38JA7|KDM5C_CANLF Lysine-specific demethylase 5C OS=Canis lupus familiaris GN=KDM5C PE=2 SV=1 129 175 8.0E-06
sp|A1YVX4|KDM5C_PIG Lysine-specific demethylase 5C OS=Sus scrofa GN=KDM5C PE=2 SV=1 129 175 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5182
MSEPEQCIICLEELPRPLAVDVANGAQADATAPTADAHKIDDDASLLDIVAALDGCEHTLHDSCIRSWAQKTNTC
PICRNPFHSVRVYNGVDGTALSTYHVEDKKQVAEFDAHQWLAQNPEPEEEERNSLPCPICNSSEREDVLLLCDGC
DAAYHTYCLGFHDIPNGDWYCMECADRFNASDDSIGSGTSDGGSTRRQARRRPAPREIRGFHVRTRARLRRARRQ
ARNAEWQGAWGQFSGRLFEMSNLDLDNHDDDEDLEQYRRFQQHDQRELRRWQQRVNIAQRLGAREEFANSIPPQI
SERLDVAPQPVESRDEIRAWGAFDRVRGTDGVNGSRSRKRRSRSVTASPAEPMPEPERKLKRPRTRRLAAQGEPA
ASASTSAAAGPSTTRPTPGSLTQSGFEIETPLVSSLLKELEPNATSEDETGATSTPRRWPPDASSPAMSPASSNL
SSPRALSTTPPPLPWTNGREVSPTLSLSTYIEPRYPPANYSPSRPASDGGDAEARPNRSEARPLELRQPRPRRPH
QVQPRAEVTSPTRLAMTVEEKKSINEIVKSALRPHWRAQKLTTEQYEAINRHVSRKLYDEVKNVSSLDDESRRTW
EKRATQEVAQAVAELHA*
Coding >OphauB2|5182
ATGTCTGAACCTGAACAGTGCATTATATGTCTTGAGGAGTTGCCGCGGCCCTTGGCTGTCGACGTGGCCAACGGT
GCACAGGCAGACGCCACAGCTCCGACGGCCGATGCACACAAGATTGATGACGATGCCAGCCTGCTCGACATTGTA
GCTGCTCTGGATGGTTGCGAGCACACTCTGCACGACTCGTGCATCCGCTCCTGGGCCCAAAAGACCAACACGTGC
CCAATCTGCCGCAATCCCTTCCATTCGGTACGAGTCTACAATGGCGTCGACGGCACTGCCCTGTCCACCTACCAC
GTCGAGGACAAGAAGCAAGTGGCCGAATTCGATGCCCACCAATGGCTGGCACAGAACCCCGAGCCCGAGGAGGAG
GAGCGGAATAGCCTCCCCTGTCCCATATGCAACTCTTCGGAACGAGAGGACGTGCTTTTACTGTGCGATGGCTGC
GATGCCGCCTACCATACCTACTGTCTTGGCTTCCACGATATACCAAATGGCGATTGGTACTGCATGGAGTGTGCC
GATAGATTTAATGCGTCAGACGACTCTATCGGCTCGGGCACATCAGATGGAGGCTCCACCCGTCGGCAAGCCCGT
CGTCGGCCGGCTCCCAGAGAAATTCGTGGCTTTCACGTTCGGACCCGTGCACGGCTTAGGAGAGCTCGTCGTCAA
GCCCGAAATGCAGAGTGGCAAGGAGCTTGGGGCCAGTTTTCTGGGCGATTGTTCGAGATGAGCAACCTTGACCTC
GACAACCACGACGATGACGAGGACCTTGAACAATACCGTCGCTTCCAGCAGCACGACCAGCGGGAGTTGCGGCGG
TGGCAGCAACGTGTCAATATTGCACAGCGCCTCGGCGCCCGCGAAGAATTCGCCAATAGCATCCCACCACAAATT
AGCGAGCGTTTAGATGTTGCGCCGCAGCCAGTCGAGTCACGAGACGAAATACGCGCCTGGGGCGCCTTTGACCGT
GTTCGAGGAACGGATGGCGTCAATGGATCACGTTCTCGTAAGCGAAGAAGCCGTTCTGTCACAGCATCTCCCGCC
GAGCCTATGCCGGAGCCCGAGAGAAAACTGAAGCGTCCCCGTACTCGGCGACTTGCGGCCCAAGGCGAACCCGCC
GCATCAGCATCCACTTCAGCCGCCGCTGGGCCATCGACAACTAGACCAACGCCAGGCTCCTTGACGCAAAGCGGC
TTCGAAATTGAAACGCCCCTTGTATCGTCGCTTCTCAAGGAATTAGAACCCAATGCCACATCTGAAGATGAGACG
GGGGCCACGTCGACACCTCGGCGTTGGCCACCTGACGCATCGTCTCCTGCAATGTCTCCAGCCTCGTCCAACCTC
AGCAGCCCCCGAGCCCTCTCAACGACCCCCCCGCCGCTCCCATGGACCAACGGTAGAGAAGTATCACCAACTCTC
TCGCTGAGTACCTATATTGAACCGAGATACCCCCCCGCCAACTACTCGCCGAGCCGACCAGCGAGTGATGGTGGC
GACGCTGAGGCGCGCCCCAACAGAAGTGAAGCCAGGCCTCTTGAGCTCCGGCAGCCTCGTCCTCGTCGGCCACAT
CAAGTGCAACCGCGTGCAGAGGTAACTTCGCCGACGCGGTTGGCCATGACGGTCGAAGAAAAGAAGAGTATTAAT
GAGATTGTCAAGAGCGCCCTGAGGCCCCACTGGCGAGCGCAAAAACTGACGACGGAGCAATATGAAGCCATCAAC
AGGCATGTGTCGCGCAAACTTTACGACGAAGTTAAAAACGTGTCGTCACTCGATGACGAGTCTCGACGTACGTGG
GAGAAGCGAGCGACGCAGGAGGTTGCCCAAGCAGTGGCTGAGCTGCACGCCTGA
Transcript >OphauB2|5182
ATGTCTGAACCTGAACAGTGCATTATATGTCTTGAGGAGTTGCCGCGGCCCTTGGCTGTCGACGTGGCCAACGGT
GCACAGGCAGACGCCACAGCTCCGACGGCCGATGCACACAAGATTGATGACGATGCCAGCCTGCTCGACATTGTA
GCTGCTCTGGATGGTTGCGAGCACACTCTGCACGACTCGTGCATCCGCTCCTGGGCCCAAAAGACCAACACGTGC
CCAATCTGCCGCAATCCCTTCCATTCGGTACGAGTCTACAATGGCGTCGACGGCACTGCCCTGTCCACCTACCAC
GTCGAGGACAAGAAGCAAGTGGCCGAATTCGATGCCCACCAATGGCTGGCACAGAACCCCGAGCCCGAGGAGGAG
GAGCGGAATAGCCTCCCCTGTCCCATATGCAACTCTTCGGAACGAGAGGACGTGCTTTTACTGTGCGATGGCTGC
GATGCCGCCTACCATACCTACTGTCTTGGCTTCCACGATATACCAAATGGCGATTGGTACTGCATGGAGTGTGCC
GATAGATTTAATGCGTCAGACGACTCTATCGGCTCGGGCACATCAGATGGAGGCTCCACCCGTCGGCAAGCCCGT
CGTCGGCCGGCTCCCAGAGAAATTCGTGGCTTTCACGTTCGGACCCGTGCACGGCTTAGGAGAGCTCGTCGTCAA
GCCCGAAATGCAGAGTGGCAAGGAGCTTGGGGCCAGTTTTCTGGGCGATTGTTCGAGATGAGCAACCTTGACCTC
GACAACCACGACGATGACGAGGACCTTGAACAATACCGTCGCTTCCAGCAGCACGACCAGCGGGAGTTGCGGCGG
TGGCAGCAACGTGTCAATATTGCACAGCGCCTCGGCGCCCGCGAAGAATTCGCCAATAGCATCCCACCACAAATT
AGCGAGCGTTTAGATGTTGCGCCGCAGCCAGTCGAGTCACGAGACGAAATACGCGCCTGGGGCGCCTTTGACCGT
GTTCGAGGAACGGATGGCGTCAATGGATCACGTTCTCGTAAGCGAAGAAGCCGTTCTGTCACAGCATCTCCCGCC
GAGCCTATGCCGGAGCCCGAGAGAAAACTGAAGCGTCCCCGTACTCGGCGACTTGCGGCCCAAGGCGAACCCGCC
GCATCAGCATCCACTTCAGCCGCCGCTGGGCCATCGACAACTAGACCAACGCCAGGCTCCTTGACGCAAAGCGGC
TTCGAAATTGAAACGCCCCTTGTATCGTCGCTTCTCAAGGAATTAGAACCCAATGCCACATCTGAAGATGAGACG
GGGGCCACGTCGACACCTCGGCGTTGGCCACCTGACGCATCGTCTCCTGCAATGTCTCCAGCCTCGTCCAACCTC
AGCAGCCCCCGAGCCCTCTCAACGACCCCCCCGCCGCTCCCATGGACCAACGGTAGAGAAGTATCACCAACTCTC
TCGCTGAGTACCTATATTGAACCGAGATACCCCCCCGCCAACTACTCGCCGAGCCGACCAGCGAGTGATGGTGGC
GACGCTGAGGCGCGCCCCAACAGAAGTGAAGCCAGGCCTCTTGAGCTCCGGCAGCCTCGTCCTCGTCGGCCACAT
CAAGTGCAACCGCGTGCAGAGGTAACTTCGCCGACGCGGTTGGCCATGACGGTCGAAGAAAAGAAGAGTATTAAT
GAGATTGTCAAGAGCGCCCTGAGGCCCCACTGGCGAGCGCAAAAACTGACGACGGAGCAATATGAAGCCATCAAC
AGGCATGTGTCGCGCAAACTTTACGACGAAGTTAAAAACGTGTCGTCACTCGATGACGAGTCTCGACGTACGTGG
GAGAAGCGAGCGACGCAGGAGGTTGCCCAAGCAGTGGCTGAGCTGCACGCCTGA
Gene >OphauB2|5182
ATGTCTGAACCTGAACAGTGCATTATATGTCTTGAGGAGTTGCCGCGGCCCTTGGCTGTCGACGTGGCCAACGGT
GCACAGGCAGACGCCACAGCTCCGACGGCCGATGCACACAAGATTGATGACGATGCCAGCCTGCTCGACATTGTA
GCTGCTCTGGATGGTTGCGAGCACACTCTGCACGACTCGTGCATCCGCTCCTGGGCCCAAAAGACCAACACGTGC
CCAATCTGCCGCAATCCCTTCCATTCGGTACGAGTCTACAATGGCGTCGACGGTAAGCAAAGCACTTCCATCTCG
TCTCTTCTTTTCCTCTCTCCCCCGCGTGGCCCTCTCTCTGGTCCAGCAAGCCAACTCCATCTTTGATGCCCAGGC
ACTGCCCTGTCCACCTACCACGTCGAGGACAAGAAGCAAGTGGCCGAATTCGATGCCCACCAATGGCTGGCACAG
AACCCCGAGCCCGAGGAGGAGGAGCGGAATAGCCTCCCCTGTCCCATATGCAACTCTTCGGAACGAGAGGACGTG
CTTTTACTGTGCGATGGCTGCGATGCCGCCTACCATACCTACTGTCTTGGCTTCCACGATATACCAAATGGCGAT
TGGTACTGCATGGAGTGTGCCGATAGATTTAATGCGTCAGACGACTCTATCGGCTCGGGCACATCAGATGGAGGC
TCCACCCGTCGGCAAGCCCGTCGTCGGCCGGCTCCCAGAGAAATTCGTGGCTTTCACGTTCGGACCCGTGCACGG
CTTAGGAGAGCTCGTCGTCAAGCCCGAAATGCAGAGTGGCAAGGAGCTTGGGGCCAGTTTTCTGGGCGATTGTTC
GAGATGAGCAACCTTGACCTCGACAACCACGACGATGACGAGGACCTTGAACAATACCGTCGCTTCCAGCAGCAC
GACCAGCGGGAGTTGCGGCGGTGGCAGCAACGTGTCAATATTGCACAGCGCCTCGGCGCCCGCGAAGAATTCGCC
AATAGCATCCCACCACAAATTAGCGAGCGTTTAGATGTTGCGCCGCAGCCAGTCGAGTCACGAGACGAAATACGC
GCCTGGGGCGCCTTTGACCGTGTTCGAGGAACGGATGGCGTCAATGGATCACGTTCTCGTAAGCGAAGAAGCCGT
TCTGTCACAGCATCTCCCGCCGAGCCTATGCCGGAGCCCGAGAGAAAACTGAAGCGTCCCCGTACTCGGCGACTT
GCGGCCCAAGGCGAACCCGCCGCATCAGCATCCACTTCAGCCGCCGCTGGGCCATCGACAACTAGACCAACGCCA
GGCTCCTTGACGCAAAGCGGCTTCGAAATTGAAACGCCCCTTGTATCGTCGCTTCTCAAGGAATTAGAACCCAAT
GCCACATCTGAAGATGAGACGGGGGCCACGTCGACACCTCGGCGTTGGCCACCTGACGCATCGTCTCCTGCAATG
TCTCCAGCCTCGTCCAACCTCAGCAGCCCCCGAGCCCTCTCAACGACCCCCCCGCCGCTCCCATGGACCAACGGT
AGAGAAGTATCACCAACTCTCTCGCTGAGTACCTATATTGAACCGAGATACCCCCCCGCCAACTACTCGCCGAGC
CGACCAGCGAGTGATGGTGGCGACGCTGAGGCGCGCCCCAACAGAAGTGAAGCCAGGCCTCTTGAGCTCCGGCAG
CCTCGTCCTCGTCGGCCACATCAAGTGCAACCGCGTGCAGAGGTAACTTCGCCGACGCGGTTGGCCATGACGGTC
GAAGAAAAGAAGAGTATTAATGAGATTGTCAAGAGCGCCCTGAGGCCCCACTGGCGAGCGCAAAAACTGACGACG
GAGCAATATGAAGCCATCAACAGGCATGTGTCGCGCAAACTTTACGACGAAGTTAAAAACGTGTCGTCACTCGAT
GACGAGTCTCGACGTACGTGGGAGAAGCGAGCGACGCAGGAGGTTGCCCAAGCAGTGGCTGAGCTGCACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail