Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5180
Gene name
LocationContig_39:87693..89218
Strand-
Gene length (bp)1525
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03435 Sacchrp_dh_NADP Saccharopine dehydrogenase NADP binding domain 1.5E-15 13 143

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3T067|SCPDL_BOVIN Saccharopine dehydrogenase-like oxidoreductase OS=Bos taurus GN=SCCPDH PE=2 SV=1 6 419 3.0E-30
sp|Q6AY30|SCPDL_RAT Saccharopine dehydrogenase-like oxidoreductase OS=Rattus norvegicus GN=Sccpdh PE=1 SV=1 6 419 3.0E-28
sp|Q8R127|SCPDL_MOUSE Saccharopine dehydrogenase-like oxidoreductase OS=Mus musculus GN=Sccpdh PE=1 SV=1 6 419 6.0E-28
sp|Q8NBX0|SCPDL_HUMAN Saccharopine dehydrogenase-like oxidoreductase OS=Homo sapiens GN=SCCPDH PE=1 SV=1 6 419 5.0E-27
sp|Q5R5C9|SCPDL_PONAB Saccharopine dehydrogenase-like oxidoreductase OS=Pongo abelii GN=SCCPDH PE=2 SV=1 6 419 6.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3T067|SCPDL_BOVIN Saccharopine dehydrogenase-like oxidoreductase OS=Bos taurus GN=SCCPDH PE=2 SV=1 6 419 3.0E-30
sp|Q6AY30|SCPDL_RAT Saccharopine dehydrogenase-like oxidoreductase OS=Rattus norvegicus GN=Sccpdh PE=1 SV=1 6 419 3.0E-28
sp|Q8R127|SCPDL_MOUSE Saccharopine dehydrogenase-like oxidoreductase OS=Mus musculus GN=Sccpdh PE=1 SV=1 6 419 6.0E-28
sp|Q8NBX0|SCPDL_HUMAN Saccharopine dehydrogenase-like oxidoreductase OS=Homo sapiens GN=SCCPDH PE=1 SV=1 6 419 5.0E-27
sp|Q5R5C9|SCPDL_PONAB Saccharopine dehydrogenase-like oxidoreductase OS=Pongo abelii GN=SCCPDH PE=2 SV=1 6 419 6.0E-27
sp|P9WGV5|TAER_MYCTU Trans-acting enoyl reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2953 PE=1 SV=1 3 423 6.0E-25
sp|P9WGV4|TAER_MYCTO Trans-acting enoyl reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3027 PE=3 SV=1 3 423 6.0E-25
sp|A5U6W1|TAER_MYCTA Trans-acting enoyl reductase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2980 PE=3 SV=1 3 423 6.0E-25
sp|A1KMU7|TAER_MYCBP Trans-acting enoyl reductase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_2974 PE=3 SV=1 3 423 6.0E-25
sp|Q7TXK2|TAER_MYCBO Trans-acting enoyl reductase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2977 PE=3 SV=1 3 423 6.0E-25
sp|A0PQ21|TAER_MYCUA Trans-acting enoyl reductase OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2000 PE=3 SV=1 3 423 9.0E-25
sp|Q7D745|Y2525_MYCTO Putative trans-acting enoyl reductase MT2525 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2525 PE=3 SV=2 8 420 1.0E-23
sp|O53176|Y2449_MYCTU Putative trans-acting enoyl reductase Rv2449c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2449c PE=1 SV=3 8 420 1.0E-23
sp|Q9CD87|TAER_MYCLE Trans-acting enoyl reductase OS=Mycobacterium leprae (strain TN) GN=ML0129 PE=3 SV=1 3 423 6.0E-22
sp|Q8LGI2|SCPDL_ARATH Probable mitochondrial saccharopine dehydrogenase-like oxidoreductase At5g39410 OS=Arabidopsis thaliana GN=At5g39410 PE=1 SV=2 10 419 3.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 294 316 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5180
MSLNQQDRQYDLVVFGATGFTGVLTTERLAMTMPMNRRWAVAGRSESKLQAVVDECKRLNPDMVEPAIEIASIDN
DEQLHSLATKTALLISTVGPYHKLGEGAFRACAEAGTHYIDCTGEVPWVLSMISKYQETAKKTGAIMVPQAGVDS
VPADVIAWTLARFVRKELDAPIGNVVVSMNGVGLTPSGGTLATVLGVQEHYSLKYLRSAMKPFALSPIPHPKGAK
GRPSMTLLQKLSGLRRFSNHGLVTTSPASMADVPIVERSWGLLSTIPSRKAEFYGPNFGFSEYFKPRNWLQGFMM
HLVLAFGAVMITFVPPFRSLLKMFIFQPGQGPSKEDMAKAWVEYRGTATPDSPAAADKVALCRVTFRQSLYSLTA
ITLAEAAFTILQGDLGLEGGIYTPACLGPAFVDRLGESGFAMDVTMVNN*
Coding >OphauB2|5180
ATGTCTCTCAACCAGCAGGATCGCCAGTACGACTTGGTCGTCTTTGGCGCCACGGGCTTCACGGGCGTCTTGACG
ACAGAGCGGCTCGCCATGACGATGCCCATGAATCGCAGGTGGGCAGTGGCTGGCCGTTCAGAGTCGAAGCTCCAG
GCCGTGGTGGATGAATGCAAGCGGCTGAATCCAGACATGGTAGAGCCGGCCATCGAGATTGCCAGCATCGATAAC
GACGAGCAGCTGCATTCGCTCGCCACCAAGACGGCGCTGCTCATCAGCACTGTCGGGCCCTACCACAAGCTCGGC
GAGGGGGCCTTTAGGGCCTGTGCCGAGGCGGGCACCCACTACATCGACTGCACGGGCGAGGTGCCGTGGGTCTTG
AGCATGATAAGCAAGTACCAAGAGACTGCCAAGAAGACGGGCGCCATCATGGTGCCCCAGGCTGGCGTCGACTCT
GTGCCGGCTGATGTGATTGCCTGGACGCTGGCGCGCTTTGTCCGCAAGGAGCTGGACGCGCCCATTGGCAATGTT
GTCGTGTCCATGAATGGAGTTGGCCTGACTCCCTCGGGCGGCACTCTGGCAACTGTCCTCGGCGTGCAAGAACAC
TATTCCCTCAAATACTTGCGCTCGGCCATGAAGCCCTTTGCGCTGTCTCCCATCCCCCACCCCAAGGGCGCAAAG
GGCCGTCCCTCAATGACCCTGCTGCAGAAGCTCTCTGGCCTCCGCCGCTTCTCCAACCACGGCCTCGTCACCACC
TCGCCGGCCTCCATGGCTGATGTTCCCATTGTGGAACGAAGCTGGGGCCTCTTGTCCACCATTCCGTCCCGCAAG
GCCGAGTTTTACGGCCCAAACTTTGGCTTTTCCGAGTACTTTAAGCCTCGCAACTGGCTCCAGGGCTTCATGATG
CATCTCGTCTTGGCCTTTGGAGCCGTCATGATTACTTTTGTGCCTCCCTTCCGCTCGCTCCTCAAGATGTTCATC
TTTCAGCCCGGCCAGGGGCCCAGCAAAGAAGACATGGCCAAGGCCTGGGTTGAATATCGCGGAACAGCAACGCCC
GACTCGCCCGCCGCCGCAGACAAGGTCGCCCTGTGCCGAGTCACCTTTCGTCAAAGTCTATACAGTCTCACTGCC
ATCACGTTGGCTGAGGCAGCCTTTACAATCTTGCAAGGCGACCTGGGTCTGGAGGGCGGCATCTATACGCCTGCA
TGTCTCGGACCGGCATTCGTCGACCGTCTTGGCGAATCGGGATTCGCCATGGATGTCACCATGGTGAACAACTAA
Transcript >OphauB2|5180
ATGTCTCTCAACCAGCAGGATCGCCAGTACGACTTGGTCGTCTTTGGCGCCACGGGCTTCACGGGCGTCTTGACG
ACAGAGCGGCTCGCCATGACGATGCCCATGAATCGCAGGTGGGCAGTGGCTGGCCGTTCAGAGTCGAAGCTCCAG
GCCGTGGTGGATGAATGCAAGCGGCTGAATCCAGACATGGTAGAGCCGGCCATCGAGATTGCCAGCATCGATAAC
GACGAGCAGCTGCATTCGCTCGCCACCAAGACGGCGCTGCTCATCAGCACTGTCGGGCCCTACCACAAGCTCGGC
GAGGGGGCCTTTAGGGCCTGTGCCGAGGCGGGCACCCACTACATCGACTGCACGGGCGAGGTGCCGTGGGTCTTG
AGCATGATAAGCAAGTACCAAGAGACTGCCAAGAAGACGGGCGCCATCATGGTGCCCCAGGCTGGCGTCGACTCT
GTGCCGGCTGATGTGATTGCCTGGACGCTGGCGCGCTTTGTCCGCAAGGAGCTGGACGCGCCCATTGGCAATGTT
GTCGTGTCCATGAATGGAGTTGGCCTGACTCCCTCGGGCGGCACTCTGGCAACTGTCCTCGGCGTGCAAGAACAC
TATTCCCTCAAATACTTGCGCTCGGCCATGAAGCCCTTTGCGCTGTCTCCCATCCCCCACCCCAAGGGCGCAAAG
GGCCGTCCCTCAATGACCCTGCTGCAGAAGCTCTCTGGCCTCCGCCGCTTCTCCAACCACGGCCTCGTCACCACC
TCGCCGGCCTCCATGGCTGATGTTCCCATTGTGGAACGAAGCTGGGGCCTCTTGTCCACCATTCCGTCCCGCAAG
GCCGAGTTTTACGGCCCAAACTTTGGCTTTTCCGAGTACTTTAAGCCTCGCAACTGGCTCCAGGGCTTCATGATG
CATCTCGTCTTGGCCTTTGGAGCCGTCATGATTACTTTTGTGCCTCCCTTCCGCTCGCTCCTCAAGATGTTCATC
TTTCAGCCCGGCCAGGGGCCCAGCAAAGAAGACATGGCCAAGGCCTGGGTTGAATATCGCGGAACAGCAACGCCC
GACTCGCCCGCCGCCGCAGACAAGGTCGCCCTGTGCCGAGTCACCTTTCGTCAAAGTCTATACAGTCTCACTGCC
ATCACGTTGGCTGAGGCAGCCTTTACAATCTTGCAAGGCGACCTGGGTCTGGAGGGCGGCATCTATACGCCTGCA
TGTCTCGGACCGGCATTCGTCGACCGTCTTGGCGAATCGGGATTCGCCATGGATGTCACCATGGTGAACAACTAA
Gene >OphauB2|5180
ATGTCTCTCAACCAGCAGGATCGCCAGTACGACTTGGTCGTCTTTGGCGCCACGGGTAAGTGAGGCCGGGCCCAT
GCTAAGCAGCAGAGCTAAGCAAACATGTAGGCTTCACGGGCGTCTTGACGACAGAGCGGCTCGCCATGACGATGC
CCATGAATCGCAGGTGGGCAGTGGCTGGCCGTTCAGAGTCGAAGCTCCAGGCCGTGGTGGATGAATGCAAGCGGC
TGAATCCAGACATGGTAGAGCCGGGTAGGACAAAGAACACAGAAATGGCTTGATGGCCTGACACGAGACTGATGG
GCGACGTGCAGCCATCGAGATTGCCAGCATCGATAACGACGAGCAGCTGCATTCGCTCGCCACCAAGACGGCGCT
GCTCATCAGCACTGTCGGGCCCTACCACAAGCTCGGCGAGGGGGCCTTTAGGGCCTGTGCCGAGGCGGGCACCCA
CTACATCGACTGCACGGGCGAGGTGCCGTGGGTCTTGAGCATGATAAGCAAGTACCAAGAGACTGCCAAGAAGAC
GGGCGCCATCATGGTGCCCCAGGCTGGCGTCGACTCTGTGCCGGCTGATGTGATTGCCTGGACGCTGGCGCGCTT
TGTCCGCAAGGAGCTGGACGCGCCCATTGGCAATGTTGTCGTGTCCATGAATGGAGTTGGGTTGGTCTCTTGATG
TGCCCCTTTTTTGCCTCTCTTTGCCCTGCTGACACTGCGGCTCTAGCCTGACTCCCTCGGGCGGCACTCTGGCAA
CTGTCCTCGGCGTGCAAGAACACTATTCCCTCAAATACTTGCGCTCGGCCATGAAGCCCTTTGCGCTGTCTCCCA
TCCCCCACCCCAAGGGCGCAAAGGGCCGTCCCTCAATGACCCTGCTGCAGAAGCTCTCTGGCCTCCGCCGCTTCT
CCAACCACGGCCTCGTCACCACCTCGCCGGCCTCCATGGCTGATGTTCCCATTGTGGAACGAAGCTGGGGCCTCT
TGTCCACCATTCCGTCCCGCAAGGCCGAGTTTTACGGCCCAAACTTTGGCTTTTCCGAGTACTTTAAGCCTCGCA
ACTGGCTCCAGGGCTTCATGATGCATCTCGTCTTGGCCTTTGGAGCCGTCATGATTACTTTTGTGCCTCCCTTCC
GCTCGCTCCTCAAGATGTTCATCTTTCAGCCCGGCCAGGGGCCCAGCAAAGAAGACATGGCCAAGGCCTGGGTTG
AATATCGCGGAACAGCAACGCCCGACTCGCCCGCCGCCGCAGACAAGGTCGCCCTGTGCCGAGTCACCTTTCGTC
AAAGTCTATACAGTCGTGAGTCTCTTGTCCAAGCACGCCTTGTACATCAACTTTGTCTTCTAATACGTCTTACCT
GTTGTCCCATCATCAAGTCACTGCCATCACGTTGGCTGAGGCAGCCTTTACAATCTTGCAAGGCGACCTGGGTCT
GGAGGGCGGCATCTATACGCCTGCATGTCTCGGACCGGCATTCGTCGACCGTCTTGGCGAATCGGGATTCGCCAT
GGATGTCACCATGGTGAACAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail