Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5175
Gene name
LocationContig_39:76028..79613
Strand+
Gene length (bp)3585
Transcript length (bp)3309
Coding sequence length (bp)3309
Protein length (aa) 1103

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15411 PH_10 Pleckstrin homology domain 1.3E-27 393 503
PF00092 VWA von Willebrand factor type A domain 6.1E-13 578 743
PF13768 VWA_3 von Willebrand factor type A domain 6.3E-10 578 731
PF13519 VWA_2 von Willebrand factor type A domain 5.2E-07 579 687

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5175
MFSRSRKSQHHRSSQAGFAPYDPGSHSLPLTSRLSDLSLLINPSKASRSPPLADGCSSQDSVGGLPFLGPTTSAS
SRRVGSIDNNVMASTAERRRLRGERTFVGGECAVCEEPLEHTLQGERILQFTCNHVAHEACFYEFIREVESQYCP
TCDAPLHLDTSRSGNVIDLNKISNLVRESRSTTSSSPAWDSQTVRAPSVDSAQRRQLSQQTVSSGRESVARGSLG
EGRDAPPSERYTSSRHARSDSEATGIASSGGYPETAQSGPPWRHGYDVQAMETSPGSSPGFCRNPIPAPTVTVRS
EFPTISRSRQQQSLTCLVTVEVADNKWRPDPEDIGVPHSHSIGTRLDDAAPASTRSAHSSRRFYPYESAEVLEEM
TLSLRSRVDNWHGLDFSKFGQLRLYGTLRVGKDKVSWQELECYLFGEMLICVKEKKLGAQWEEGEAGRRASRCTL
KGSILIKKHLNEVAETGAMDENMLTLSLSVAELPQFHLRFDNRNQLKLWNQALLDINAVEEAPLRSPFYERGESE
TDEEGEWQRSRAQRVSSTASSWGPRSVTTAPTEYTNMGSRSPQLGSSVHVPIDVVVVVPISSSMQGVKINLVRDA
LKFMVKNLGERDRMGLVTFGSGGGGVPIVGMTTKAWAGWSNILTCIKPVGQKSHRADVVEGANVAMDLLMQRKHN
NPIATIMLISDASTADADSVDFVVSRAEAAKITMHSFGLGMTHKPDTMLELSTRTKAAYTYVKDWMMLRECLAGC
LGSMQTLSHQNVKLKLKLPEGSPAKFYKINGALQVTKRATGRDAEASLGDLRFGDKRDILVQLVIAPDNSSQEHL
PQDAWDNIVSGLEALGGSMENDAERLVSVEEVPLIQADVSWGDMLRDGTLTHMPRPSLLAITMLPASPAHKKPWQ
ASPPIPSHPSIVQRRMELLTSDMLIRALTLVSRGQHDRAHTLLCETRSILKGLGKGGLPPIPPLAAKPSPSAMDP
ADRKPSPSPPTSAASSGNGYAPTPYTARPHDPVGLGSGAIDPATVAALETELESSLEWINHPAVFARDSRKAVLQ
AIGVISSQRAFTFRTPIEGLWAARVAGIRRLADKSREWREEGGGEGGITEEA*
Coding >OphauB2|5175
ATGTTCAGTCGGTCTCGCAAGAGCCAGCATCACCGAAGCAGCCAGGCTGGCTTTGCCCCTTACGACCCGGGGAGC
CATAGCTTGCCTTTAACGTCGCGTCTTTCCGATCTGAGCCTCTTGATCAATCCCAGCAAGGCGTCTCGGTCTCCT
CCTCTGGCTGATGGTTGCTCGTCGCAAGACTCGGTGGGCGGCCTGCCTTTTCTGGGCCCAACGACGAGCGCTTCC
TCTCGCAGAGTGGGCAGCATCGACAACAACGTCATGGCGAGCACGGCCGAGAGGCGCCGTCTGCGTGGCGAGAGG
ACCTTTGTTGGCGGCGAATGCGCCGTTTGCGAGGAGCCTCTGGAGCACACGCTGCAGGGCGAGCGCATCCTGCAG
TTTACATGCAACCACGTTGCTCACGAGGCTTGTTTCTACGAGTTTATCCGTGAGGTAGAGTCACAGTATTGTCCC
ACATGCGACGCGCCGCTGCATCTGGATACCAGCCGCAGCGGCAACGTGATTGATCTGAACAAGATTAGCAACCTG
GTGCGCGAGTCGCGCTCCACCACGTCGTCAAGCCCGGCTTGGGACAGCCAGACTGTAAGAGCGCCGAGTGTGGAT
AGCGCACAGAGGCGCCAGCTATCACAGCAGACGGTGAGCAGCGGGCGCGAGAGCGTGGCGCGAGGCAGTCTTGGA
GAGGGCCGCGACGCTCCGCCCTCTGAGCGCTACACGTCGTCGAGGCATGCGCGCAGCGACAGCGAGGCAACGGGC
ATTGCATCCTCGGGCGGCTATCCCGAGACGGCGCAGAGCGGCCCGCCGTGGCGGCACGGCTACGATGTGCAGGCC
ATGGAGACGTCGCCTGGCAGCTCGCCGGGTTTTTGCCGCAACCCGATTCCTGCTCCGACGGTGACGGTGCGCTCA
GAGTTTCCCACGATTAGCCGCTCCCGCCAGCAGCAGTCGCTCACCTGTCTTGTCACGGTTGAGGTTGCCGACAAC
AAGTGGAGGCCGGACCCCGAGGACATTGGCGTGCCGCACTCGCATTCCATTGGCACGCGGCTCGACGACGCGGCT
CCGGCTTCGACCAGGTCGGCCCACAGCAGCCGGCGCTTCTATCCGTACGAATCAGCCGAGGTGCTGGAGGAAATG
ACGCTCAGCCTGCGCAGCCGGGTGGACAACTGGCACGGGCTCGACTTTAGCAAATTCGGGCAGCTGCGGCTGTAC
GGCACGCTGCGAGTGGGCAAGGACAAGGTGTCGTGGCAGGAGCTGGAATGCTATCTGTTTGGCGAGATGCTCATT
TGCGTCAAGGAAAAGAAGCTGGGGGCGCAGTGGGAGGAAGGCGAGGCGGGGCGCAGAGCAAGCCGGTGCACGCTC
AAGGGCTCCATCCTCATCAAGAAGCACCTCAACGAGGTGGCGGAGACGGGGGCCATGGACGAAAACATGCTGACG
CTGAGCCTGTCGGTGGCGGAGCTTCCGCAGTTCCACCTCCGATTCGACAACCGCAACCAGCTCAAGCTCTGGAAC
CAGGCGCTGCTGGACATCAACGCGGTGGAGGAGGCGCCGCTGCGCAGCCCGTTTTACGAGCGGGGCGAGTCGGAG
ACGGACGAGGAGGGCGAGTGGCAGCGCTCGCGGGCGCAGCGGGTGTCGTCGACGGCGTCGTCGTGGGGCCCGCGG
TCAGTGACGACGGCGCCGACCGAGTACACCAACATGGGGTCGCGCAGCCCGCAGCTGGGCAGCTCGGTGCATGTG
CCGATTGACGTGGTGGTGGTTGTGCCCATTTCATCGTCGATGCAGGGCGTCAAGATCAACCTGGTGCGGGATGCG
CTCAAGTTCATGGTGAAGAACCTGGGGGAGCGAGACCGCATGGGGCTGGTGACGTTTGGGTCGGGGGGCGGCGGC
GTGCCCATTGTGGGCATGACGACCAAGGCGTGGGCAGGCTGGAGCAACATCTTGACGTGCATCAAGCCCGTGGGC
CAAAAGAGCCACCGGGCCGACGTGGTGGAGGGCGCCAACGTGGCCATGGACCTGCTGATGCAGCGCAAGCACAAC
AACCCCATTGCCACGATTATGCTCATTAGCGACGCGTCGACGGCCGACGCCGACTCGGTCGACTTTGTGGTGTCG
CGGGCCGAGGCGGCCAAGATCACGATGCACTCGTTTGGCCTGGGCATGACGCACAAGCCCGACACCATGCTGGAG
CTGTCGACGCGCACCAAGGCGGCCTATACGTACGTCAAGGACTGGATGATGCTGCGCGAGTGCCTGGCGGGCTGC
CTGGGATCCATGCAGACGCTGTCGCACCAAAACGTCAAGCTCAAGCTCAAGCTGCCCGAGGGCTCGCCGGCCAAG
TTTTACAAGATCAATGGCGCGCTGCAGGTGACGAAGCGTGCCACGGGGCGCGACGCCGAGGCCAGCCTGGGCGAC
CTGCGCTTTGGCGACAAGCGCGACATCCTGGTGCAGCTCGTCATTGCGCCCGACAACTCGTCGCAGGAGCATCTG
CCCCAGGATGCCTGGGACAACATTGTCTCGGGGCTCGAGGCGCTGGGCGGCTCCATGGAAAACGACGCCGAGCGC
CTTGTGTCGGTGGAGGAGGTGCCGCTGATCCAGGCCGACGTCAGCTGGGGCGACATGCTGCGCGACGGCACCCTC
ACCCACATGCCGCGCCCCTCGCTGCTGGCCATTACCATGCTGCCCGCCAGCCCGGCGCACAAGAAGCCATGGCAG
GCTTCTCCGCCCATCCCCTCGCACCCCAGCATTGTCCAGCGCCGCATGGAGCTGCTGACGTCGGACATGCTCATC
CGCGCCCTGACCCTCGTCAGCCGCGGCCAGCACGACCGCGCCCATACCCTGCTGTGCGAGACGCGCTCCATCCTC
AAGGGCCTCGGCAAGGGCGGCCTGCCTCCCATCCCGCCCCTGGCTGCCAAGCCGTCGCCCAGCGCCATGGACCCT
GCCGACCGCAAGCCCAGCCCCTCGCCGCCCACCTCGGCCGCCTCGTCGGGCAACGGCTATGCCCCAACGCCCTAT
ACTGCCCGCCCCCACGACCCCGTCGGCCTGGGCTCGGGCGCCATTGACCCTGCCACCGTGGCCGCCCTCGAGACG
GAGCTTGAGAGCAGCCTCGAGTGGATCAACCATCCCGCCGTCTTTGCCCGTGACAGCCGCAAGGCCGTCTTGCAG
GCCATTGGCGTCATCAGCTCCCAGCGCGCCTTTACCTTTCGCACCCCCATTGAGGGCCTCTGGGCCGCCCGTGTT
GCCGGTATCCGCCGCCTGGCAGACAAGAGCCGTGAGTGGCGCGAAGAGGGAGGAGGCGAGGGTGGTATTACTGAA
GAGGCTTGA
Transcript >OphauB2|5175
ATGTTCAGTCGGTCTCGCAAGAGCCAGCATCACCGAAGCAGCCAGGCTGGCTTTGCCCCTTACGACCCGGGGAGC
CATAGCTTGCCTTTAACGTCGCGTCTTTCCGATCTGAGCCTCTTGATCAATCCCAGCAAGGCGTCTCGGTCTCCT
CCTCTGGCTGATGGTTGCTCGTCGCAAGACTCGGTGGGCGGCCTGCCTTTTCTGGGCCCAACGACGAGCGCTTCC
TCTCGCAGAGTGGGCAGCATCGACAACAACGTCATGGCGAGCACGGCCGAGAGGCGCCGTCTGCGTGGCGAGAGG
ACCTTTGTTGGCGGCGAATGCGCCGTTTGCGAGGAGCCTCTGGAGCACACGCTGCAGGGCGAGCGCATCCTGCAG
TTTACATGCAACCACGTTGCTCACGAGGCTTGTTTCTACGAGTTTATCCGTGAGGTAGAGTCACAGTATTGTCCC
ACATGCGACGCGCCGCTGCATCTGGATACCAGCCGCAGCGGCAACGTGATTGATCTGAACAAGATTAGCAACCTG
GTGCGCGAGTCGCGCTCCACCACGTCGTCAAGCCCGGCTTGGGACAGCCAGACTGTAAGAGCGCCGAGTGTGGAT
AGCGCACAGAGGCGCCAGCTATCACAGCAGACGGTGAGCAGCGGGCGCGAGAGCGTGGCGCGAGGCAGTCTTGGA
GAGGGCCGCGACGCTCCGCCCTCTGAGCGCTACACGTCGTCGAGGCATGCGCGCAGCGACAGCGAGGCAACGGGC
ATTGCATCCTCGGGCGGCTATCCCGAGACGGCGCAGAGCGGCCCGCCGTGGCGGCACGGCTACGATGTGCAGGCC
ATGGAGACGTCGCCTGGCAGCTCGCCGGGTTTTTGCCGCAACCCGATTCCTGCTCCGACGGTGACGGTGCGCTCA
GAGTTTCCCACGATTAGCCGCTCCCGCCAGCAGCAGTCGCTCACCTGTCTTGTCACGGTTGAGGTTGCCGACAAC
AAGTGGAGGCCGGACCCCGAGGACATTGGCGTGCCGCACTCGCATTCCATTGGCACGCGGCTCGACGACGCGGCT
CCGGCTTCGACCAGGTCGGCCCACAGCAGCCGGCGCTTCTATCCGTACGAATCAGCCGAGGTGCTGGAGGAAATG
ACGCTCAGCCTGCGCAGCCGGGTGGACAACTGGCACGGGCTCGACTTTAGCAAATTCGGGCAGCTGCGGCTGTAC
GGCACGCTGCGAGTGGGCAAGGACAAGGTGTCGTGGCAGGAGCTGGAATGCTATCTGTTTGGCGAGATGCTCATT
TGCGTCAAGGAAAAGAAGCTGGGGGCGCAGTGGGAGGAAGGCGAGGCGGGGCGCAGAGCAAGCCGGTGCACGCTC
AAGGGCTCCATCCTCATCAAGAAGCACCTCAACGAGGTGGCGGAGACGGGGGCCATGGACGAAAACATGCTGACG
CTGAGCCTGTCGGTGGCGGAGCTTCCGCAGTTCCACCTCCGATTCGACAACCGCAACCAGCTCAAGCTCTGGAAC
CAGGCGCTGCTGGACATCAACGCGGTGGAGGAGGCGCCGCTGCGCAGCCCGTTTTACGAGCGGGGCGAGTCGGAG
ACGGACGAGGAGGGCGAGTGGCAGCGCTCGCGGGCGCAGCGGGTGTCGTCGACGGCGTCGTCGTGGGGCCCGCGG
TCAGTGACGACGGCGCCGACCGAGTACACCAACATGGGGTCGCGCAGCCCGCAGCTGGGCAGCTCGGTGCATGTG
CCGATTGACGTGGTGGTGGTTGTGCCCATTTCATCGTCGATGCAGGGCGTCAAGATCAACCTGGTGCGGGATGCG
CTCAAGTTCATGGTGAAGAACCTGGGGGAGCGAGACCGCATGGGGCTGGTGACGTTTGGGTCGGGGGGCGGCGGC
GTGCCCATTGTGGGCATGACGACCAAGGCGTGGGCAGGCTGGAGCAACATCTTGACGTGCATCAAGCCCGTGGGC
CAAAAGAGCCACCGGGCCGACGTGGTGGAGGGCGCCAACGTGGCCATGGACCTGCTGATGCAGCGCAAGCACAAC
AACCCCATTGCCACGATTATGCTCATTAGCGACGCGTCGACGGCCGACGCCGACTCGGTCGACTTTGTGGTGTCG
CGGGCCGAGGCGGCCAAGATCACGATGCACTCGTTTGGCCTGGGCATGACGCACAAGCCCGACACCATGCTGGAG
CTGTCGACGCGCACCAAGGCGGCCTATACGTACGTCAAGGACTGGATGATGCTGCGCGAGTGCCTGGCGGGCTGC
CTGGGATCCATGCAGACGCTGTCGCACCAAAACGTCAAGCTCAAGCTCAAGCTGCCCGAGGGCTCGCCGGCCAAG
TTTTACAAGATCAATGGCGCGCTGCAGGTGACGAAGCGTGCCACGGGGCGCGACGCCGAGGCCAGCCTGGGCGAC
CTGCGCTTTGGCGACAAGCGCGACATCCTGGTGCAGCTCGTCATTGCGCCCGACAACTCGTCGCAGGAGCATCTG
CCCCAGGATGCCTGGGACAACATTGTCTCGGGGCTCGAGGCGCTGGGCGGCTCCATGGAAAACGACGCCGAGCGC
CTTGTGTCGGTGGAGGAGGTGCCGCTGATCCAGGCCGACGTCAGCTGGGGCGACATGCTGCGCGACGGCACCCTC
ACCCACATGCCGCGCCCCTCGCTGCTGGCCATTACCATGCTGCCCGCCAGCCCGGCGCACAAGAAGCCATGGCAG
GCTTCTCCGCCCATCCCCTCGCACCCCAGCATTGTCCAGCGCCGCATGGAGCTGCTGACGTCGGACATGCTCATC
CGCGCCCTGACCCTCGTCAGCCGCGGCCAGCACGACCGCGCCCATACCCTGCTGTGCGAGACGCGCTCCATCCTC
AAGGGCCTCGGCAAGGGCGGCCTGCCTCCCATCCCGCCCCTGGCTGCCAAGCCGTCGCCCAGCGCCATGGACCCT
GCCGACCGCAAGCCCAGCCCCTCGCCGCCCACCTCGGCCGCCTCGTCGGGCAACGGCTATGCCCCAACGCCCTAT
ACTGCCCGCCCCCACGACCCCGTCGGCCTGGGCTCGGGCGCCATTGACCCTGCCACCGTGGCCGCCCTCGAGACG
GAGCTTGAGAGCAGCCTCGAGTGGATCAACCATCCCGCCGTCTTTGCCCGTGACAGCCGCAAGGCCGTCTTGCAG
GCCATTGGCGTCATCAGCTCCCAGCGCGCCTTTACCTTTCGCACCCCCATTGAGGGCCTCTGGGCCGCCCGTGTT
GCCGGTATCCGCCGCCTGGCAGACAAGAGCCGTGAGTGGCGCGAAGAGGGAGGAGGCGAGGGTGGTATTACTGAA
GAGGCTTGA
Gene >OphauB2|5175
ATGTTCAGTCGGTCTCGCAAGAGCCAGCATCACCGAAGCAGCCAGGCTGGCTTTGCCCCTTACGACCCGGGGAGC
CATAGCTTGCCTTTAACGTCGCGTCTTTCCGATCTGAGCCTCTTGATCAATCCCAGCAAGGCGTCTCGGTCTCCT
CCTCTGGCTGATGGTTGCTCGTCGCAAGACTCGGGTCCGTTGTCCCTCTGCTCACTGCTCATACTTGTACATGAC
TTGGTGCTGCCGTCAAGGCGTCTTGATGCCGTGCGTTGCATGACTGACTCTTTTCTTTGGCCTCTTGTGCTTTTG
CAGGCTACCTATACCAACAAAGTGCAAGACGTGCAAACATAGTGGGCGGCCTGCCTTTTCTGGGCCCAACGACGA
GCGCTTCCTCTCGCAGAGTGGGCAGCATCGACAACAACGTCATGGCGAGCACGGCCGAGAGGCGCCGTCTGCGTG
GCGAGAGGACCTTTGTTGGCGGCGAATGCGCCGTTTGCGAGGAGCCTCTGGAGCACACGCTGCAGGGCGAGCGCA
TCCTGCAGTTTACATGCAACCACGTTGCTCACGAGGCTTGTTTCTACGAGTTTATCCGTGAGGTAGAGTCACAGT
ATTGTCCCACATGCGACGCGCCGCTGCATCTGGATACCAGCCGCAGCGGCAACGTGATTGATCTGAGTGCGTCTT
GTTGTACATTTCAGGCGTGCCGAGCAGGCTTGCTGACGGCCTGAGCAGACAAGATTAGCAACCTGGTGCGCGAGT
CGCGCTCCACCACGTCGTCAAGCCCGGCTTGGGACAGCCAGACTGTAAGAGCGCCGAGTGTGGATAGCGCACAGA
GGCGCCAGCTATCACAGCAGACGGTGAGCAGCGGGCGCGAGAGCGTGGCGCGAGGCAGTCTTGGAGAGGGCCGCG
ACGCTCCGCCCTCTGAGCGCTACACGTCGTCGAGGCATGCGCGCAGCGACAGCGAGGCAACGGGCATTGCATCCT
CGGGCGGCTATCCCGAGACGGCGCAGAGCGGCCCGCCGTGGCGGCACGGCTACGATGTGCAGGCCATGGAGACGT
CGCCTGGCAGCTCGCCGGGTTTTTGCCGCAACCCGATTCCTGCTCCGACGGTGACGGTGCGCTCAGAGTTTCCCA
CGATTAGCCGCTCCCGCCAGCAGCAGTCGCTCACCTGTCTTGTCACGGTTGAGGTTGCCGACAACAAGTGGAGGC
CGGACCCCGAGGACATTGGCGTGCCGCACTCGCATTCCATTGGCACGCGGCTCGACGACGCGGCTCCGGCTTCGA
CCAGGTCGGCCCACAGCAGCCGGCGCTTCTATCCGTACGAATCAGCCGAGGTGCTGGAGGAAATGACGCTCAGCC
TGCGCAGCCGGGTGGACAACTGGCACGGGCTCGACTTTAGCAAGCAAGTGTGGCGGCATCATGGTAGTGGAGCAG
CAGTGGGCTAACATGAGTGTGTGGCACAGATTCGGGCAGCTGCGGCTGTACGGCACGCTGCGAGTGGGCAAGGAC
AAGGTGTCGTGGCAGGAGCTGGAATGCTATCTGTTTGGCGAGATGCTCATTTGCGTCAAGGAAAAGAAGCTGGGG
GCGCAGTGGGAGGAAGGCGAGGCGGGGCGCAGAGCAAGCCGGTGCACGCTCAAGGGCTCCATCCTCATCAAGAAG
CACCTCAACGAGGTGGCGGAGACGGGGGCCATGGACGAAAACATGCTGACGCTGAGCCTGTCGGTGGCGGAGCTT
CCGCAGTTCCACCTCCGATTCGACAACCGCAACCAGCTCAAGCTCTGGAACCAGGCGCTGCTGGACATCAACGCG
GTGGAGGAGGCGCCGCTGCGCAGCCCGTTTTACGAGCGGGGCGAGTCGGAGACGGACGAGGAGGGCGAGTGGCAG
CGCTCGCGGGCGCAGCGGGTGTCGTCGACGGCGTCGTCGTGGGGCCCGCGGTCAGTGACGACGGCGCCGACCGAG
TACACCAACATGGGGTCGCGCAGCCCGCAGCTGGGCAGCTCGGTGCATGTGCCGATTGACGTGGTGGTGGTTGTG
CCCATTTCATCGTCGATGCAGGGCGTCAAGATCAACCTGGTGCGGGATGCGCTCAAGTTCATGGTGAAGAACCTG
GGGGAGCGAGACCGCATGGGGCTGGTGACGTTTGGGTCGGGGGGCGGCGGCGTGCCCATTGTGGGCATGACGACC
AAGGCGTGGGCAGGCTGGAGCAACATCTTGACGTGCATCAAGCCCGTGGGCCAAAAGAGCCACCGGGCCGACGTG
GTGGAGGGCGCCAACGTGGCCATGGACCTGCTGATGCAGCGCAAGCACAACAACCCCATTGCCACGATTATGCTC
ATTAGCGACGCGTCGACGGCCGACGCCGACTCGGTCGACTTTGTGGTGTCGCGGGCCGAGGCGGCCAAGATCACG
ATGCACTCGTTTGGCCTGGGCATGACGCACAAGCCCGACACCATGCTGGAGCTGTCGACGCGCACCAAGGCGGCC
TATACGTACGTCAAGGACTGGATGATGCTGCGCGAGTGCCTGGCGGGCTGCCTGGGATCCATGCAGACGCTGTCG
CACCAAAACGTCAAGCTCAAGCTCAAGCTGCCCGAGGGCTCGCCGGCCAAGTTTTACAAGATCAATGGCGCGCTG
CAGGTGACGAAGCGTGCCACGGGGCGCGACGCCGAGGCCAGCCTGGGCGACCTGCGCTTTGGCGACAAGCGCGAC
ATCCTGGTGCAGCTCGTCATTGCGCCCGACAACTCGTCGCAGGAGCATCTGCCCCAGGATGCCTGGGACAACATT
GTCTCGGGGCTCGAGGCGCTGGGCGGCTCCATGGAAAACGACGCCGAGCGCCTTGTGTCGGTGGAGGAGGTGCCG
CTGATCCAGGCCGACGTCAGCTGGGGCGACATGCTGCGCGACGGCACCCTCACCCACATGCCGCGCCCCTCGCTG
CTGGCCATTACCATGCTGCCCGCCAGCCCGGCGCACAAGAAGCCATGGCAGGCTTCTCCGCCCATCCCCTCGCAC
CCCAGCATTGTCCAGCGCCGCATGGAGCTGCTGACGTCGGACATGCTCATCCGCGCCCTGACCCTCGTCAGCCGC
GGCCAGCACGACCGCGCCCATACCCTGCTGTGCGAGACGCGCTCCATCCTCAAGGGCCTCGGCAAGGGCGGCCTG
CCTCCCATCCCGCCCCTGGCTGCCAAGCCGTCGCCCAGCGCCATGGACCCTGCCGACCGCAAGCCCAGCCCCTCG
CCGCCCACCTCGGCCGCCTCGTCGGGCAACGGCTATGCCCCAACGCCCTATACTGCCCGCCCCCACGACCCCGTC
GGCCTGGGCTCGGGCGCCATTGACCCTGCCACCGTGGCCGCCCTCGAGACGGAGCTTGAGAGCAGCCTCGAGTGG
ATCAACCATCCCGCCGTCTTTGCCCGTGACAGCCGCAAGGCCGTCTTGCAGGCCATTGGCGTCATCAGCTCCCAG
CGCGCCTTTACCTTTCGCACCCCCATTGAGGGCCTCTGGGCCGCCCGTGTTGCCGGTATCCGCCGCCTGGCAGAC
AAGAGCCGTGAGTGGCGCGAAGAGGGAGGAGGCGAGGGTGGTATTACTGAAGAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail