Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5164
Gene name
LocationContig_39:34072..34735
Strand-
Gene length (bp)663
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11754 Velvet Velvet factor 1.2E-19 6 76
PF11754 Velvet Velvet factor 9.0E-32 78 185

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2412
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1777
Ophiocordyceps australis map64 (Brazil) OphauB2|5164 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06514
Ophiocordyceps camponoti-rufipedis Ophun1|5611
Ophiocordyceps kimflemingae Ophio5|6610
Ophiocordyceps subramaniannii Hirsu2|3415

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5164
MNDVRFRLDLRQQPKAARACGFGDRDRRVIDPPPIVQLVVESSTMTDEEVRSYLRYESYVMNCSICDETGTRDAS
FMPEEYQHQRRLMGSLVGTPFVGQDEYGQEGCFFCFGDLSCRTPGAFRLKFTLIMIDPARAGIIRHFPILTEALS
DVFHVYSAKEFPGMLPSSDLAKRLKEQGCIISIKKGGDRPKNARVQDDLSDMDEDCDGPHGQRKRRTPRE*
Coding >OphauB2|5164
ATGAATGACGTTCGTTTCCGACTCGACCTTCGCCAGCAGCCAAAGGCCGCTAGAGCATGCGGTTTTGGCGACAGA
GACAGGCGTGTCATTGATCCTCCCCCCATTGTTCAGTTGGTTGTGGAGAGCTCTACCATGACGGATGAAGAGGTC
CGCTCATACCTGCGCTATGAAAGCTACGTCATGAACTGCTCCATTTGCGACGAGACGGGAACTCGCGATGCCTCC
TTTATGCCAGAAGAGTATCAGCACCAGCGGCGCCTGATGGGCTCTCTTGTCGGTACCCCTTTTGTTGGTCAGGAC
GAGTATGGACAAGAGGGCTGCTTCTTTTGCTTTGGAGATCTCTCTTGCCGAACCCCAGGCGCATTTCGACTCAAG
TTCACCTTGATTATGATTGATCCAGCTCGTGCTGGAATCATCAGGCATTTTCCCATTCTAACAGAGGCTTTAAGC
GACGTCTTTCACGTATACAGCGCCAAAGAATTCCCGGGCATGCTCCCTAGCAGCGATTTAGCCAAGCGTCTCAAG
GAGCAAGGTTGCATCATCTCCATCAAGAAGGGAGGCGACAGACCTAAAAACGCTAGGGTTCAGGACGACTTGTCC
GATATGGACGAAGATTGCGATGGCCCGCATGGACAAAGGAAGAGACGCACACCCAGGGAATAG
Transcript >OphauB2|5164
ATGAATGACGTTCGTTTCCGACTCGACCTTCGCCAGCAGCCAAAGGCCGCTAGAGCATGCGGTTTTGGCGACAGA
GACAGGCGTGTCATTGATCCTCCCCCCATTGTTCAGTTGGTTGTGGAGAGCTCTACCATGACGGATGAAGAGGTC
CGCTCATACCTGCGCTATGAAAGCTACGTCATGAACTGCTCCATTTGCGACGAGACGGGAACTCGCGATGCCTCC
TTTATGCCAGAAGAGTATCAGCACCAGCGGCGCCTGATGGGCTCTCTTGTCGGTACCCCTTTTGTTGGTCAGGAC
GAGTATGGACAAGAGGGCTGCTTCTTTTGCTTTGGAGATCTCTCTTGCCGAACCCCAGGCGCATTTCGACTCAAG
TTCACCTTGATTATGATTGATCCAGCTCGTGCTGGAATCATCAGGCATTTTCCCATTCTAACAGAGGCTTTAAGC
GACGTCTTTCACGTATACAGCGCCAAAGAATTCCCGGGCATGCTCCCTAGCAGCGATTTAGCCAAGCGTCTCAAG
GAGCAAGGTTGCATCATCTCCATCAAGAAGGGAGGCGACAGACCTAAAAACGCTAGGGTTCAGGACGACTTGTCC
GATATGGACGAAGATTGCGATGGCCCGCATGGACAAAGGAAGAGACGCACACCCAGGGAATAG
Gene >OphauB2|5164
ATGAATGACGTTCGTTTCCGACTCGACCTTCGCCAGCAGCCAAAGGCCGCTAGAGCATGCGGTTTTGGCGACAGA
GACAGGCGTGTCATTGATCCTCCCCCCATTGTTCAGTTGGTTGTGGAGAGCTCTACCATGACGGATGAAGAGGTC
CGCTCATACCTGCGCTATGAAAGCTACGTCATGAACTGCTCCATTTGCGACGAGACGGGAACTCGCGATGCCTCC
TTTATGCCAGAAGAGTATCAGCACCAGCGGCGCCTGATGGGCTCTCTTGTCGGTACCCCTTTTGTTGGTCAGGAC
GAGTATGGACAAGAGGGCTGCTTCTTTTGCTTTGGAGATCTCTCTTGCCGAACCCCAGGCGCATTTCGACTCAAG
TTCACCTTGATTATGATTGATCCAGCTCGTGCTGGAATCATCAGGCATTTTCCCATTCTAACAGAGGCTTTAAGC
GACGTCTTTCACGTATACAGCGCCAAAGAATTCCCGGGCATGCTCCCTAGCAGCGATTTAGCCAAGCGTCTCAAG
GAGCAAGGTTGCATCATCTCCATCAAGAAGGGAGGCGACAGACCTAAAAACGCTAGGGTTCAGGACGACTTGTCC
GATATGGACGAAGATTGCGATGGCCCGCATGGACAAAGGAAGAGACGCACACCCAGGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail