Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5152
Gene name
LocationContig_39:2230..4742
Strand+
Gene length (bp)2512
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 5.6E-23 44 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92609|TBCD5_HUMAN TBC1 domain family member 5 OS=Homo sapiens GN=TBC1D5 PE=1 SV=1 42 379 4.0E-54
sp|Q80XQ2|TBCD5_MOUSE TBC1 domain family member 5 OS=Mus musculus GN=Tbc1d5 PE=1 SV=2 42 366 5.0E-52
sp|Q54TA5|TBC5B_DICDI TBC1 domain family member 5 homolog B OS=Dictyostelium discoideum GN=tbc1d5B PE=3 SV=1 247 391 1.0E-26
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 118 346 9.0E-23
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 118 346 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92609|TBCD5_HUMAN TBC1 domain family member 5 OS=Homo sapiens GN=TBC1D5 PE=1 SV=1 42 379 4.0E-54
sp|Q80XQ2|TBCD5_MOUSE TBC1 domain family member 5 OS=Mus musculus GN=Tbc1d5 PE=1 SV=2 42 366 5.0E-52
sp|Q54TA5|TBC5B_DICDI TBC1 domain family member 5 homolog B OS=Dictyostelium discoideum GN=tbc1d5B PE=3 SV=1 247 391 1.0E-26
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 118 346 9.0E-23
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 118 346 6.0E-22
sp|Q9URY3|YLOH_SCHPO TBC domain-containing protein C1952.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.17c PE=3 SV=4 136 365 2.0E-18
sp|Q54VM3|TBC5A_DICDI TBC1 domain family member 5 homolog A OS=Dictyostelium discoideum GN=tbc1d5A PE=1 SV=1 202 397 3.0E-17
sp|Q54TA5|TBC5B_DICDI TBC1 domain family member 5 homolog B OS=Dictyostelium discoideum GN=tbc1d5B PE=3 SV=1 41 222 5.0E-17
sp|O59737|GYP1_SCHPO GTPase-activating protein gyp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp1 PE=3 SV=1 110 346 4.0E-09
sp|Q8R5A6|TB22A_MOUSE TBC1 domain family member 22A OS=Mus musculus GN=Tbc1d22a PE=1 SV=3 116 346 2.0E-08
sp|Q8WUA7|TB22A_HUMAN TBC1 domain family member 22A OS=Homo sapiens GN=TBC1D22A PE=1 SV=2 116 346 5.0E-08
sp|Q95KI1|TB22A_MACFA TBC1 domain family member 22A (Fragment) OS=Macaca fascicularis GN=TBC1D22A PE=2 SV=2 116 346 7.0E-08
sp|Q55G97|TBCK_DICDI TBC domain-containing protein kinase-like protein OS=Dictyostelium discoideum GN=tbck PE=3 SV=1 253 364 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5152
MRSLQEAQRRWQATKDVCANTASLRRAIRQGGSESPCVCGCRSVCWKALLMSRDSSAKGWRQALDEGRRGYIRLR
SQFLKYIEHPEELTELNVDPLADDPESPWTTLREDELIRAEILQDVERLPDEASYHQDSTRAAILDILFIYCKAN
PGHGGYRQGMHELLAPIVYVVEQDAIDAASAQDSSLPPPLDPSMLQVVNSAYVEHDAYLLFSRLMEHAQAFYNVS
DEGNGPSCAKPNSTPQDTRSAIVDRSKLIHNVCLQKLDWELASHLSNVDILPQIFLIRWIRLLFSREFPFDQVLI
LWDSIFAVDPSLDLVDFICCAMLIRIRSQLLQADYSACLQLLLKYPRPEAPYLAHMFVNDAIHLRDDMSAAGGAA
LMAKYEDRQPDTLTPSPLPGSVPSSPQRSGSLGHRGFGTRSPLPSPSRLMQNSGGVESLWQGAAKSAKGVLERGE
RLGLNQAVREAMTEIRRNMHSFQEARHSPRASRDFASQESAVQAFAALQRRNKQLADLLDETVTNLKAISVLKLQ
DKTKSLELIEIAAAKIQFVQVYLNESSLQVPTFDTATASSAQYTATQIQAEDETVSRKQSSEDGCGPVAEKIGSV
AMSDDDDEPRPTVAEERIPCVATVARSAHGKVAVEELSNGEGVVQASIPLRPAAPMPTRSTLAQSSFSWMLEPED
TIACRKQGPERKFLPVLHKKRTSRNVSSERNAFLFGDVAVDADSQAALRSDDIFGMEPMHSARNERPDL*
Coding >OphauB2|5152
ATGAGGTCCCTGCAAGAGGCGCAACGGAGATGGCAGGCCACCAAAGATGTTTGTGCAAATACAGCCAGCCTGCGG
CGCGCTATCAGACAAGGAGGTAGTGAGAGCCCCTGTGTGTGCGGCTGCCGTTCGGTCTGCTGGAAGGCCCTTCTC
ATGTCAAGAGACAGCTCGGCCAAAGGCTGGAGGCAGGCACTTGATGAGGGCAGAAGAGGCTATATTCGCTTGAGG
AGTCAATTTCTCAAATACATCGAGCACCCTGAAGAACTGACTGAGCTCAATGTCGACCCTCTGGCCGACGACCCC
GAATCGCCTTGGACCACATTGCGAGAAGATGAGCTGATTCGTGCCGAAATCCTGCAAGACGTCGAGCGTCTTCCT
GACGAAGCTAGCTATCATCAAGACAGCACGCGAGCTGCAATACTTGACATCCTCTTCATCTACTGCAAGGCCAAC
CCTGGCCACGGGGGCTACCGCCAGGGAATGCACGAGCTTCTGGCGCCTATTGTGTATGTTGTTGAGCAGGATGCG
ATTGATGCAGCGTCTGCACAGGACTCGTCATTGCCGCCCCCTTTGGACCCGTCAATGCTACAAGTTGTCAATTCG
GCGTATGTTGAACATGATGCCTATCTTCTCTTCTCGCGGCTCATGGAGCACGCTCAGGCCTTTTATAATGTTTCC
GACGAAGGAAATGGCCCGTCATGCGCCAAGCCAAACTCGACGCCACAGGACACTCGGTCGGCCATTGTCGATAGA
AGCAAGTTGATCCATAATGTCTGCCTGCAAAAACTAGACTGGGAGCTTGCGTCTCACCTTTCCAATGTCGACATT
CTGCCTCAAATATTCCTCATTCGGTGGATTCGGCTTCTCTTCAGTCGGGAATTTCCCTTTGACCAGGTTCTCATA
TTGTGGGATTCCATTTTTGCCGTCGATCCCTCACTCGACTTGGTAGACTTTATATGCTGCGCAATGCTCATTCGC
ATACGCTCTCAATTGCTGCAGGCAGACTACTCGGCATGTCTACAATTACTTCTCAAATATCCCCGACCCGAAGCA
CCTTACTTGGCACACATGTTTGTCAACGATGCCATCCACCTCCGAGACGACATGTCGGCTGCAGGCGGGGCAGCT
CTCATGGCCAAGTATGAGGATAGACAACCCGACACTTTGACTCCATCGCCGCTTCCTGGCTCTGTCCCCTCCAGC
CCCCAAAGGTCGGGTTCTCTTGGCCACAGAGGGTTCGGTACGAGATCCCCTTTGCCGTCACCGTCTAGGTTGATG
CAGAATTCAGGGGGCGTGGAGTCGCTGTGGCAAGGCGCAGCCAAGAGTGCCAAGGGCGTCTTGGAACGAGGAGAA
AGGTTGGGCCTCAATCAAGCCGTGCGTGAGGCCATGACGGAAATACGGCGAAATATGCACAGTTTTCAAGAAGCT
CGCCACTCACCTAGAGCCTCAAGAGACTTTGCGAGCCAAGAGAGCGCTGTACAGGCCTTTGCCGCGCTCCAAAGA
CGCAACAAGCAGCTTGCTGATTTGCTGGACGAGACGGTGACCAATCTCAAGGCTATATCAGTTTTGAAGCTCCAG
GACAAGACCAAGAGCCTTGAACTCATTGAGATTGCAGCCGCCAAAATCCAATTTGTACAAGTGTACCTGAATGAG
TCTTCACTCCAAGTGCCCACATTTGACACCGCGACAGCGTCAAGTGCTCAATACACAGCAACCCAAATACAGGCA
GAAGATGAGACAGTCTCAAGGAAGCAAAGCTCCGAAGACGGATGCGGGCCCGTAGCAGAAAAAATTGGCTCGGTT
GCCATGTCTGATGATGACGACGAGCCGAGGCCAACTGTTGCAGAGGAAAGGATACCATGTGTGGCCACGGTAGCG
CGGAGCGCCCATGGCAAAGTGGCGGTTGAAGAGCTCAGCAACGGAGAAGGGGTCGTCCAGGCCTCAATACCCCTG
CGGCCGGCAGCACCTATGCCCACCCGTTCAACACTTGCACAGTCGTCCTTTTCGTGGATGCTGGAGCCTGAAGAT
ACCATTGCCTGTCGGAAACAGGGACCCGAGCGCAAGTTTCTGCCAGTGCTTCACAAGAAGCGAACGTCGAGAAAT
GTTAGCAGTGAACGCAACGCATTCCTCTTTGGCGATGTGGCGGTAGATGCCGACTCGCAAGCAGCTCTGCGGTCC
GACGACATTTTTGGAATGGAGCCAATGCACAGCGCCAGGAATGAACGACCCGATCTGTAA
Transcript >OphauB2|5152
ATGAGGTCCCTGCAAGAGGCGCAACGGAGATGGCAGGCCACCAAAGATGTTTGTGCAAATACAGCCAGCCTGCGG
CGCGCTATCAGACAAGGAGGTAGTGAGAGCCCCTGTGTGTGCGGCTGCCGTTCGGTCTGCTGGAAGGCCCTTCTC
ATGTCAAGAGACAGCTCGGCCAAAGGCTGGAGGCAGGCACTTGATGAGGGCAGAAGAGGCTATATTCGCTTGAGG
AGTCAATTTCTCAAATACATCGAGCACCCTGAAGAACTGACTGAGCTCAATGTCGACCCTCTGGCCGACGACCCC
GAATCGCCTTGGACCACATTGCGAGAAGATGAGCTGATTCGTGCCGAAATCCTGCAAGACGTCGAGCGTCTTCCT
GACGAAGCTAGCTATCATCAAGACAGCACGCGAGCTGCAATACTTGACATCCTCTTCATCTACTGCAAGGCCAAC
CCTGGCCACGGGGGCTACCGCCAGGGAATGCACGAGCTTCTGGCGCCTATTGTGTATGTTGTTGAGCAGGATGCG
ATTGATGCAGCGTCTGCACAGGACTCGTCATTGCCGCCCCCTTTGGACCCGTCAATGCTACAAGTTGTCAATTCG
GCGTATGTTGAACATGATGCCTATCTTCTCTTCTCGCGGCTCATGGAGCACGCTCAGGCCTTTTATAATGTTTCC
GACGAAGGAAATGGCCCGTCATGCGCCAAGCCAAACTCGACGCCACAGGACACTCGGTCGGCCATTGTCGATAGA
AGCAAGTTGATCCATAATGTCTGCCTGCAAAAACTAGACTGGGAGCTTGCGTCTCACCTTTCCAATGTCGACATT
CTGCCTCAAATATTCCTCATTCGGTGGATTCGGCTTCTCTTCAGTCGGGAATTTCCCTTTGACCAGGTTCTCATA
TTGTGGGATTCCATTTTTGCCGTCGATCCCTCACTCGACTTGGTAGACTTTATATGCTGCGCAATGCTCATTCGC
ATACGCTCTCAATTGCTGCAGGCAGACTACTCGGCATGTCTACAATTACTTCTCAAATATCCCCGACCCGAAGCA
CCTTACTTGGCACACATGTTTGTCAACGATGCCATCCACCTCCGAGACGACATGTCGGCTGCAGGCGGGGCAGCT
CTCATGGCCAAGTATGAGGATAGACAACCCGACACTTTGACTCCATCGCCGCTTCCTGGCTCTGTCCCCTCCAGC
CCCCAAAGGTCGGGTTCTCTTGGCCACAGAGGGTTCGGTACGAGATCCCCTTTGCCGTCACCGTCTAGGTTGATG
CAGAATTCAGGGGGCGTGGAGTCGCTGTGGCAAGGCGCAGCCAAGAGTGCCAAGGGCGTCTTGGAACGAGGAGAA
AGGTTGGGCCTCAATCAAGCCGTGCGTGAGGCCATGACGGAAATACGGCGAAATATGCACAGTTTTCAAGAAGCT
CGCCACTCACCTAGAGCCTCAAGAGACTTTGCGAGCCAAGAGAGCGCTGTACAGGCCTTTGCCGCGCTCCAAAGA
CGCAACAAGCAGCTTGCTGATTTGCTGGACGAGACGGTGACCAATCTCAAGGCTATATCAGTTTTGAAGCTCCAG
GACAAGACCAAGAGCCTTGAACTCATTGAGATTGCAGCCGCCAAAATCCAATTTGTACAAGTGTACCTGAATGAG
TCTTCACTCCAAGTGCCCACATTTGACACCGCGACAGCGTCAAGTGCTCAATACACAGCAACCCAAATACAGGCA
GAAGATGAGACAGTCTCAAGGAAGCAAAGCTCCGAAGACGGATGCGGGCCCGTAGCAGAAAAAATTGGCTCGGTT
GCCATGTCTGATGATGACGACGAGCCGAGGCCAACTGTTGCAGAGGAAAGGATACCATGTGTGGCCACGGTAGCG
CGGAGCGCCCATGGCAAAGTGGCGGTTGAAGAGCTCAGCAACGGAGAAGGGGTCGTCCAGGCCTCAATACCCCTG
CGGCCGGCAGCACCTATGCCCACCCGTTCAACACTTGCACAGTCGTCCTTTTCGTGGATGCTGGAGCCTGAAGAT
ACCATTGCCTGTCGGAAACAGGGACCCGAGCGCAAGTTTCTGCCAGTGCTTCACAAGAAGCGAACGTCGAGAAAT
GTTAGCAGTGAACGCAACGCATTCCTCTTTGGCGATGTGGCGGTAGATGCCGACTCGCAAGCAGCTCTGCGGTCC
GACGACATTTTTGGAATGGAGCCAATGCACAGCGCCAGGAATGAACGACCCGATCTGTAA
Gene >OphauB2|5152
ATGAGGTCCCTGCAAGAGGCGCAGTAAGCGACGACAGAGCCCAAAGGCCGGTTTGAGCTGACGGCCCTCGCCCAA
GACGGAGATGGCAGGCCACCAAAGATGTTTGTGCAAATACAGCCAGCCTGCGGCGCGCTATCAGACAAGGAGGTA
GTGAGAGCCCCTGTGTGTGCGGCTGCCGTTCGGTCTGCTGGAAGGTCTGTTGGACTCGTCGCTGGTGCTTCAAGT
TGGACTGACGGTTGCTGCAACAGGCCCTTCTCATGTCAAGAGACAGCTCGGCCAAAGGCTGGAGGCAGGCACTTG
ATGAGGGCAGAAGAGGCTATATTCGCTTGAGGAGTCAATTTCTCAAATACATCGAGCACCCTGAAGAACTGACTG
AGCTCAATGTCGACCCTCTGGCCGACGACCCCGAAGTGAGCCTTGGAACCCACGATGCCCCATCCATGTCGTGTT
GCTGACACCATGGGCAGTCGCCTTGGACCACATTGCGAGAAGATGAGCTGATTCGTGCCGAAATCCTGCAAGACG
TCGAGCGTCTTCCTGACGAAGCTAGCTATCATCAAGACAGCACGCGAGCTGCAATACTTGACATCCTCTTCATCT
ACTGCAAGGCCAACCCTGGCCACGGGGGCTACCGCCAGGGAATGCACGAGCTTCTGGCGCCTATTGTGTATGTTG
TTGAGCAGGATGCGATTGATGCAGCGTCTGCACAGGACTCGTCATTGCCGCCCCCTTTGGACCCGTCAATGCTAC
AAGTTGTCAATTCGGCGTATGTTGAACATGATGCCTATCTTCTCTTCTCGCGGCTCATGGAGCACGCTCAGGCCT
TTTATAATGTTTCCGACGAAGGAAATGGCCCGTCATGCGCCAAGCCAAACTCGACGCCACAGGACACTCGGTCGG
CCATTGTCGATAGAAGCAAGTTGATCCATAATGTCTGCCTGCAAAAACTAGACTGGGAGCTTGCGTCTCACCTTT
CCAATGTCGACATTCTGCCTCAAATATTCCTCATGTAAGGTCACAAAAGTCTCTGCCTGCAATACGAGTCCTAAT
TATTGCCAAAGTCGGTGGATTCGGCTTCTCTTCAGTCGGGAATTTCCCTTTGACCAGGTTCTCATATTGTGGGAT
TCCATTTTTGCCGTCGATCCCTCACTCGACTTGGTAGACTTTATATGCTGCGCAATGCTCATTCGCATACGCTCT
CAATGTTGGTATTCAGCCGGTACAGGGGTCGATGCGATCAAGGTTAATGAATTCTGGCTCTCTAGTGCTGCAGGC
AGACTACTCGGCATGTCTACAATTACTTCTCAAATATCCCCGACCCGAAGCACCTTACTTGGCACACATGTTTGT
CAACGATGCCATCCACCTCCGAGACGACATGTCGGCTGCAGGCGGGGCAGCTCTCATGGCCAAGTATGAGGATAG
ACAACCCGACACTTTGACTCCATCGCCGCTTCCTGGCTCTGTCCCCTCCAGCCCCCAAAGGTCGGGTTCTCTTGG
CCACAGAGGGTTCGGTACGAGATCCCCTTTGCCGTCACCGTCTAGGTTGATGCAGAATTCAGGGGGCGTGGAGTC
GCTGTGGCAAGGCGCAGCCAAGAGTGCCAAGGGCGTCTTGGAACGAGGAGAAAGGTTGGGCCTCAATCAAGCCGT
GCGTGAGGCCATGACGGAAATACGGCGAAATATGCACAGTTTTCAAGAAGCTCGCCACTCACCTAGAGCCTCAAG
AGACTTTGCGAGCCAAGAGAGCGCTGTACAGGCCTTTGCCGCGCTCCAAAGACGCAACAAGCAGCTTGCTGATTT
GCTGGACGAGACGGTGACCAATCTCAAGGCTATATCAGTTTTGAAGCTCCAGGACAAGACCAAGAGCCTTGAACT
CATTGAGATTGCAGCCGCCAAAATCCAATTTGTACAAGTGTACCTGAATGAGTCTTCACTCCAAGTGCCCACATT
TGACACCGCGACAGCGTCAAGTGCTCAATACACAGCAACCCAAATACAGGCAGAAGATGAGACAGTCTCAAGGAA
GCAAAGCTCCGAAGACGGATGCGGGCCCGTAGCAGAAAAAATTGGCTCGGTTGCCATGTCTGATGATGACGACGA
GCCGAGGCCAACTGTTGCAGAGGAAAGGATACCATGTGTGGCCACGGTAGCGCGGAGCGCCCATGGCAAAGTGGC
GGTTGAAGAGCTCAGCAACGGAGAAGGGGTCGTCCAGGCCTCAATACCCCTGCGGCCGGCAGCACCTATGCCCAC
CCGTTCAACACTTGCACAGTCGTCCTTTTCGTGGATGCTGGAGCCTGAAGATACCATTGCCTGTCGGAAACAGGG
ACCCGAGCGCAAGTTTCTGCCAGTGCTTCACAAGAAGCGAACGTCGAGAAATGTTAGCAGTGAACGCAACGCATT
CCTCTTTGGCGATGTGGCGGTAGATGCCGACTCGCAAGCAGCTCTGCGGTCCGACGACATTTTTGGAATGGAGCC
AATGCACAGCGCCAGGAATGAACGACCCGATCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail