Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5150
Gene name
LocationContig_387:576..3401
Strand-
Gene length (bp)2825
Transcript length (bp)2772
Coding sequence length (bp)2772
Protein length (aa) 924

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04811 Sec23_trunk Sec23/Sec24 trunk domain 5.8E-68 319 560
PF04815 Sec23_helical Sec23/Sec24 helical domain 6.8E-23 660 761
PF08033 Sec23_BS Sec23/Sec24 beta-sandwich domain 2.9E-17 566 649
PF04810 zf-Sec23_Sec24 Sec23/Sec24 zinc finger 1.1E-16 245 282
PF00626 Gelsolin Gelsolin repeat 4.6E-09 789 859

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CLE0|SEC24_KLULA Protein transport protein SEC24 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC24 PE=3 SV=1 152 922 0.0E+00
sp|P0CR41|SEC24_CRYNB Protein transport protein SEC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEC24 PE=3 SV=1 185 922 0.0E+00
sp|A3LRW3|SEC24_PICST Protein transport protein SEC24 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC24 PE=3 SV=2 35 922 0.0E+00
sp|A5DSK2|SEC24_LODEL Protein transport protein SEC24 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC24 PE=3 SV=1 121 922 0.0E+00
sp|Q5AQ76|SEC24_CANAL Protein transport protein SEC24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC24 PE=3 SV=1 153 922 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CLE0|SEC24_KLULA Protein transport protein SEC24 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC24 PE=3 SV=1 152 922 0.0E+00
sp|P0CR41|SEC24_CRYNB Protein transport protein SEC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEC24 PE=3 SV=1 185 922 0.0E+00
sp|A3LRW3|SEC24_PICST Protein transport protein SEC24 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC24 PE=3 SV=2 35 922 0.0E+00
sp|A5DSK2|SEC24_LODEL Protein transport protein SEC24 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC24 PE=3 SV=1 121 922 0.0E+00
sp|Q5AQ76|SEC24_CANAL Protein transport protein SEC24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC24 PE=3 SV=1 153 922 0.0E+00
sp|Q75B16|SEC24_ASHGO Protein transport protein SEC24 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC24 PE=3 SV=1 35 921 0.0E+00
sp|A5DPC0|SEC24_PICGU Protein transport protein SEC24 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC24 PE=3 SV=2 152 923 0.0E+00
sp|Q6FWD3|SC242_CANGA Protein transport protein SEC24-2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC242 PE=3 SV=1 127 923 0.0E+00
sp|Q875Q0|SEC24_LACK1 Protein transport protein SEC24 (Fragment) OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SEC24 PE=3 SV=1 153 905 0.0E+00
sp|Q86ZK8|SEC24_PODAS Protein transport protein SEC24 OS=Podospora anserina GN=SEC24 PE=3 SV=1 1 922 0.0E+00
sp|Q876F5|SC242_SACU7 Protein transport protein SEC24-2 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=SEC242 PE=3 SV=1 76 923 0.0E+00
sp|P40482|SEC24_YEAST Protein transport protein SEC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC24 PE=1 SV=1 71 923 0.0E+00
sp|Q6FX11|SC241_CANGA Protein transport protein SEC24-1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC241 PE=3 SV=1 64 923 0.0E+00
sp|P53953|SFB2_YEAST SED5-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFB2 PE=1 SV=1 141 923 0.0E+00
sp|Q876F4|SC241_SACU7 Protein transport protein SEC24-1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=SEC241 PE=3 SV=1 154 923 0.0E+00
sp|Q875V8|SC241_NAUCC Protein transport protein SEC24-1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=SEC241 PE=3 SV=1 152 921 0.0E+00
sp|Q875V7|SC242_NAUCC Protein transport protein SEC24-2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=SEC242 PE=3 SV=1 75 923 0.0E+00
sp|Q6BT80|SEC24_DEBHA Protein transport protein SEC24 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC24 PE=3 SV=2 87 922 0.0E+00
sp|Q2HH63|SEC24_CHAGB Protein transport protein SEC24 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC24 PE=3 SV=1 32 922 0.0E+00
sp|Q7S4P3|SEC24_NEUCR Protein transport protein sec24 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec24 PE=3 SV=1 32 922 0.0E+00
sp|A4QUL1|SEC24_MAGO7 Protein transport protein SEC24 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC24 PE=3 SV=1 29 922 0.0E+00
sp|Q5B6W0|SEC24_EMENI Protein transport protein sec24 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec24 PE=3 SV=1 5 922 0.0E+00
sp|A1CUC3|SEC24_ASPCL Protein transport protein sec24 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec24 PE=3 SV=1 15 922 0.0E+00
sp|Q1E6U9|SEC24_COCIM Protein transport protein SEC24 OS=Coccidioides immitis (strain RS) GN=SEC24 PE=3 SV=2 32 922 0.0E+00
sp|Q4WLP1|SEC24_ASPFU Protein transport protein sec24 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec24 PE=3 SV=2 4 922 0.0E+00
sp|Q2ULI0|SEC24_ASPOR Protein transport protein sec24 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec24 PE=3 SV=1 4 922 0.0E+00
sp|Q0CSL7|SEC24_ASPTN Protein transport protein sec24 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec24 PE=3 SV=1 32 922 0.0E+00
sp|A2QSG6|SEC24_ASPNC Protein transport protein sec24 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec24 PE=3 SV=1 34 922 0.0E+00
sp|Q6C2T4|SEC24_YARLI Protein transport protein SEC24 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC24 PE=3 SV=1 15 923 0.0E+00
sp|Q9UUI5|SEC24_SCHPO Protein transport protein sec24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec24 PE=2 SV=1 113 922 0.0E+00
sp|Q0PVD8|SEC24_PICPA Protein transport protein SEC24 OS=Komagataella pastoris GN=SEC24 PE=3 SV=1 38 922 0.0E+00
sp|Q4P9K4|SEC24_USTMA Protein transport protein SEC24 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEC24 PE=3 SV=1 168 922 0.0E+00
sp|P0CR40|SEC24_CRYNJ Protein transport protein SEC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEC24 PE=3 SV=1 185 922 0.0E+00
sp|A1DP06|SEC24_NEOFI Protein transport protein SEC24 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec24 PE=3 SV=1 4 922 0.0E+00
sp|O95487|SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens GN=SEC24B PE=1 SV=2 64 922 2.0E-164
sp|Q3U2P1|SC24A_MOUSE Protein transport protein Sec24A OS=Mus musculus GN=Sec24a PE=1 SV=1 193 923 1.0E-163
sp|A6QNT8|SC24A_BOVIN Protein transport protein Sec24A OS=Bos taurus GN=SEC24A PE=2 SV=1 193 923 1.0E-160
sp|O95486|SC24A_HUMAN Protein transport protein Sec24A OS=Homo sapiens GN=SEC24A PE=1 SV=2 193 923 2.0E-159
sp|Q9SFU0|SC24A_ARATH Protein transport protein Sec24-like At3g07100 OS=Arabidopsis thaliana GN=At3g07100 PE=2 SV=2 193 922 4.0E-147
sp|Q54U61|SEC24_DICDI Protein transport protein SEC24 OS=Dictyostelium discoideum GN=sec24 PE=3 SV=1 194 922 2.0E-136
sp|Q9M291|SC24C_ARATH Protein transport protein Sec24-like CEF OS=Arabidopsis thaliana GN=CEF PE=2 SV=3 97 922 7.0E-118
sp|O94855|SC24D_HUMAN Protein transport protein Sec24D OS=Homo sapiens GN=SEC24D PE=1 SV=2 192 905 2.0E-110
sp|Q9M081|SC24B_ARATH Protein transport protein Sec24-like At4g32640 OS=Arabidopsis thaliana GN=At4g32640 PE=2 SV=3 192 915 2.0E-105
sp|P53992|SC24C_HUMAN Protein transport protein Sec24C OS=Homo sapiens GN=SEC24C PE=1 SV=3 192 905 6.0E-105
sp|Q9USS7|YNB3_SCHPO Uncharacterized protein C4.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4.03c PE=2 SV=1 163 922 5.0E-95
sp|P38810|SFB3_YEAST SED5-binding protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFB3 PE=1 SV=1 26 922 2.0E-60
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0008270 zinc ion binding Yes
GO:0030127 COPII vesicle coat Yes
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0046914 transition metal ion binding No
GO:0005575 cellular_component No
GO:0045184 establishment of protein localization No
GO:0005488 binding No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0003674 molecular_function No
GO:0051641 cellular localization No
GO:0016192 vesicle-mediated transport No
GO:0015031 protein transport No
GO:0033036 macromolecule localization No
GO:0043167 ion binding No
GO:0030120 vesicle coat No
GO:0051179 localization No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0032991 protein-containing complex No
GO:0030117 membrane coat No
GO:0098796 membrane protein complex No
GO:0048193 Golgi vesicle transport No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5150
MSAPGSDELGHVAGQQQPEQALDGVSGATGLGKKKKRGYAAQAFEVGTGPNASMTGQMACASVPVPYGYSSVQQA
GQQQQAQYADAQQAANADSHAGVLAGQHVQPAHRASYAQPEQSYPLPAGAGVAGMTQGMGAMHLGGQAQQAPSNM
TPLNQLYPTDLMNQPFAVSELDLPPPPIMLAPNTSVTPSPAANCPPRYIRSTLNAVPTTNSLLKKSKLPFALIVQ
PYGSLHDDEDDIAVIQDQVISRCRRCRTYINPFVTFLDQGHRWRCNMCNLSNDVPSAFDWDTAAQQTVDRWQRHE
LNHAVVEFVAPQEYMVRPPQPLVYLFLLDVSYAAVSNGLLATSARTILDSLNRIPNADRRTRLGFLAVDASLHYF
SIPKDQDETAETSMLVVSDLDEPFLPVPHDLLVPLSESRQSIEGFLQKLPDMFHNNQSNGSCMGSALRAGHKLIS
ALGGKIVLLTASLPNIGAGKLDMREDKKLLGTSKEGSLLQTGSSFYKSFAVECSKSQVSIDMFLFSSHYQDVASL
SNLPRYTGGQTWFYPGWHASRPEDALKFASELSDYLSSEIGLEAVLRVRATTGLRMSAFYGNFFNRSSDLCAFPA
FPRDQCYVVEVAMDENMTKNTVCLQAAVLHTTCNGERRIRVLTLCLPTTTSLSDVFASADQCAITTYFSHKAVER
TLSSGLEAARDALQAKLTELLQTFKKELAGGSMGAGLQFPANLRGLPSLFLGLIKNVGLRKSAQIPSDIRSAALC
LLSTLPVPLLMRYIYPRLYSLHDMPDNAGIPDEETGQIVLPSPLNLTSERFVSYGLYLIDDGQTQFLWIGRDAVP
QLISDVFGVEDRTQVHVGKGRVPELDNDFNERVRAVIQKSRDHRSLGVGSITVPHLYIVREDGEPSLKLWAQTLL
VEDRADQSLSSAQWLGVLREKVG*
Coding >OphauB2|5150
ATGTCAGCGCCCGGTAGCGATGAGCTCGGCCATGTGGCTGGGCAACAGCAGCCAGAGCAGGCATTGGACGGCGTC
TCTGGCGCCACGGGATTGGGAAAGAAGAAGAAGCGGGGATACGCTGCGCAGGCGTTTGAGGTTGGCACTGGCCCC
AATGCTTCAATGACTGGGCAGATGGCATGCGCCTCTGTGCCTGTGCCCTATGGCTACTCGTCTGTGCAGCAAGCA
GGGCAACAGCAGCAAGCACAGTATGCGGATGCCCAGCAAGCTGCAAATGCCGATTCGCATGCAGGCGTCTTGGCT
GGCCAGCATGTCCAGCCTGCGCATCGAGCAAGCTATGCGCAGCCCGAGCAGTCGTATCCGCTGCCTGCTGGGGCC
GGTGTGGCTGGCATGACGCAGGGCATGGGCGCTATGCACCTGGGCGGCCAGGCTCAACAAGCGCCATCAAACATG
ACACCCTTGAATCAACTCTACCCAACCGACCTCATGAATCAGCCCTTTGCTGTGTCGGAGCTCGATTTGCCTCCG
CCCCCCATCATGCTGGCACCAAATACGAGTGTGACGCCTTCGCCAGCTGCAAATTGCCCTCCACGCTATATCCGG
TCAACCCTGAATGCTGTTCCAACCACAAACTCACTGCTCAAAAAGTCCAAGTTGCCCTTTGCCCTCATTGTGCAG
CCCTACGGCTCCCTGCACGACGACGAGGACGACATAGCTGTCATTCAGGACCAAGTCATATCGCGCTGTCGCCGT
TGCAGGACCTATATCAATCCCTTTGTTACCTTTTTGGACCAGGGCCACCGCTGGAGATGCAACATGTGCAATCTC
AGCAACGACGTTCCCTCAGCCTTTGATTGGGACACGGCAGCTCAGCAGACGGTTGATCGCTGGCAGCGACATGAA
CTGAACCATGCTGTAGTAGAGTTTGTCGCCCCTCAGGAGTACATGGTTCGCCCCCCACAGCCTCTGGTTTACCTT
TTTCTCTTGGATGTGAGCTACGCGGCCGTGTCTAACGGTCTGCTGGCCACGAGCGCACGCACTATACTCGACAGC
CTCAATCGGATACCAAATGCCGACCGTCGCACCCGACTTGGCTTCTTGGCCGTCGACGCCAGCTTGCACTATTTT
TCAATTCCCAAGGACCAAGATGAAACCGCCGAAACGAGTATGCTCGTCGTCAGCGATCTTGACGAGCCCTTTTTG
CCTGTGCCTCACGACCTTCTGGTTCCTTTGAGCGAGAGTCGCCAAAGCATAGAAGGCTTCCTACAGAAGCTTCCC
GACATGTTTCACAACAACCAGAGCAATGGCTCATGTATGGGCTCGGCTCTACGCGCCGGCCATAAGCTCATATCA
GCTCTCGGCGGCAAGATTGTCCTTCTCACTGCCTCTCTCCCCAACATTGGAGCTGGAAAGTTGGACATGCGAGAG
GACAAGAAGCTGTTGGGTACTTCCAAGGAAGGCAGTCTTTTGCAGACTGGAAGCAGCTTCTACAAGAGCTTTGCT
GTCGAGTGTTCCAAGAGTCAAGTTTCAATCGACATGTTTCTCTTTTCTTCCCACTATCAGGATGTTGCATCTCTC
AGCAACTTGCCGAGATATACAGGCGGCCAAACCTGGTTTTACCCTGGCTGGCACGCCTCTCGACCCGAAGACGCT
CTCAAGTTTGCGTCCGAGTTGAGCGACTACTTGTCATCTGAAATTGGGCTAGAAGCTGTGCTACGTGTCCGTGCC
ACGACTGGCCTACGCATGAGCGCCTTTTATGGCAACTTTTTCAATCGCAGCTCCGATCTCTGCGCCTTTCCAGCC
TTTCCCCGAGACCAATGCTACGTGGTCGAGGTGGCCATGGATGAAAACATGACCAAAAACACTGTCTGTCTCCAA
GCAGCTGTGCTACACACAACGTGTAATGGTGAGCGCCGCATCCGGGTCCTCACCTTGTGTCTACCCACAACGACA
AGTCTATCAGATGTCTTTGCGTCGGCAGATCAATGTGCCATTACTACCTATTTCAGCCACAAGGCTGTCGAGAGG
ACTTTGAGTAGTGGCTTGGAGGCTGCCCGCGACGCTCTTCAGGCCAAGCTTACCGAACTGCTCCAGACCTTCAAA
AAGGAGCTGGCTGGTGGGAGTATGGGCGCCGGCTTGCAGTTTCCTGCCAATCTTCGCGGCCTGCCGTCTCTCTTT
CTAGGCTTGATCAAGAATGTTGGCTTACGCAAATCGGCGCAAATTCCTTCAGACATACGCTCAGCAGCTCTCTGT
CTCCTTTCAACACTGCCCGTGCCGCTACTGATGCGTTATATCTATCCTCGGCTCTACTCCTTGCATGATATGCCG
GACAATGCCGGCATCCCCGACGAGGAAACGGGACAGATTGTCCTGCCATCGCCCCTTAATTTGACATCGGAGCGT
TTCGTATCGTATGGGCTCTACTTGATTGACGATGGACAGACGCAGTTCTTGTGGATTGGCCGCGATGCGGTGCCT
CAGCTCATATCCGATGTATTTGGCGTCGAGGACAGAACCCAGGTACACGTGGGCAAAGGGCGGGTTCCCGAACTC
GACAATGATTTCAATGAGCGAGTCAGGGCCGTCATTCAAAAAAGCCGTGACCATCGATCCCTTGGCGTGGGTAGC
ATTACAGTTCCACACCTATATATTGTCCGCGAGGATGGGGAGCCGAGCCTGAAGCTCTGGGCTCAAACACTCCTG
GTGGAGGATCGGGCTGACCAGAGTCTAAGCTCTGCCCAGTGGCTGGGCGTCTTGAGAGAAAAGGTTGGTTAA
Transcript >OphauB2|5150
ATGTCAGCGCCCGGTAGCGATGAGCTCGGCCATGTGGCTGGGCAACAGCAGCCAGAGCAGGCATTGGACGGCGTC
TCTGGCGCCACGGGATTGGGAAAGAAGAAGAAGCGGGGATACGCTGCGCAGGCGTTTGAGGTTGGCACTGGCCCC
AATGCTTCAATGACTGGGCAGATGGCATGCGCCTCTGTGCCTGTGCCCTATGGCTACTCGTCTGTGCAGCAAGCA
GGGCAACAGCAGCAAGCACAGTATGCGGATGCCCAGCAAGCTGCAAATGCCGATTCGCATGCAGGCGTCTTGGCT
GGCCAGCATGTCCAGCCTGCGCATCGAGCAAGCTATGCGCAGCCCGAGCAGTCGTATCCGCTGCCTGCTGGGGCC
GGTGTGGCTGGCATGACGCAGGGCATGGGCGCTATGCACCTGGGCGGCCAGGCTCAACAAGCGCCATCAAACATG
ACACCCTTGAATCAACTCTACCCAACCGACCTCATGAATCAGCCCTTTGCTGTGTCGGAGCTCGATTTGCCTCCG
CCCCCCATCATGCTGGCACCAAATACGAGTGTGACGCCTTCGCCAGCTGCAAATTGCCCTCCACGCTATATCCGG
TCAACCCTGAATGCTGTTCCAACCACAAACTCACTGCTCAAAAAGTCCAAGTTGCCCTTTGCCCTCATTGTGCAG
CCCTACGGCTCCCTGCACGACGACGAGGACGACATAGCTGTCATTCAGGACCAAGTCATATCGCGCTGTCGCCGT
TGCAGGACCTATATCAATCCCTTTGTTACCTTTTTGGACCAGGGCCACCGCTGGAGATGCAACATGTGCAATCTC
AGCAACGACGTTCCCTCAGCCTTTGATTGGGACACGGCAGCTCAGCAGACGGTTGATCGCTGGCAGCGACATGAA
CTGAACCATGCTGTAGTAGAGTTTGTCGCCCCTCAGGAGTACATGGTTCGCCCCCCACAGCCTCTGGTTTACCTT
TTTCTCTTGGATGTGAGCTACGCGGCCGTGTCTAACGGTCTGCTGGCCACGAGCGCACGCACTATACTCGACAGC
CTCAATCGGATACCAAATGCCGACCGTCGCACCCGACTTGGCTTCTTGGCCGTCGACGCCAGCTTGCACTATTTT
TCAATTCCCAAGGACCAAGATGAAACCGCCGAAACGAGTATGCTCGTCGTCAGCGATCTTGACGAGCCCTTTTTG
CCTGTGCCTCACGACCTTCTGGTTCCTTTGAGCGAGAGTCGCCAAAGCATAGAAGGCTTCCTACAGAAGCTTCCC
GACATGTTTCACAACAACCAGAGCAATGGCTCATGTATGGGCTCGGCTCTACGCGCCGGCCATAAGCTCATATCA
GCTCTCGGCGGCAAGATTGTCCTTCTCACTGCCTCTCTCCCCAACATTGGAGCTGGAAAGTTGGACATGCGAGAG
GACAAGAAGCTGTTGGGTACTTCCAAGGAAGGCAGTCTTTTGCAGACTGGAAGCAGCTTCTACAAGAGCTTTGCT
GTCGAGTGTTCCAAGAGTCAAGTTTCAATCGACATGTTTCTCTTTTCTTCCCACTATCAGGATGTTGCATCTCTC
AGCAACTTGCCGAGATATACAGGCGGCCAAACCTGGTTTTACCCTGGCTGGCACGCCTCTCGACCCGAAGACGCT
CTCAAGTTTGCGTCCGAGTTGAGCGACTACTTGTCATCTGAAATTGGGCTAGAAGCTGTGCTACGTGTCCGTGCC
ACGACTGGCCTACGCATGAGCGCCTTTTATGGCAACTTTTTCAATCGCAGCTCCGATCTCTGCGCCTTTCCAGCC
TTTCCCCGAGACCAATGCTACGTGGTCGAGGTGGCCATGGATGAAAACATGACCAAAAACACTGTCTGTCTCCAA
GCAGCTGTGCTACACACAACGTGTAATGGTGAGCGCCGCATCCGGGTCCTCACCTTGTGTCTACCCACAACGACA
AGTCTATCAGATGTCTTTGCGTCGGCAGATCAATGTGCCATTACTACCTATTTCAGCCACAAGGCTGTCGAGAGG
ACTTTGAGTAGTGGCTTGGAGGCTGCCCGCGACGCTCTTCAGGCCAAGCTTACCGAACTGCTCCAGACCTTCAAA
AAGGAGCTGGCTGGTGGGAGTATGGGCGCCGGCTTGCAGTTTCCTGCCAATCTTCGCGGCCTGCCGTCTCTCTTT
CTAGGCTTGATCAAGAATGTTGGCTTACGCAAATCGGCGCAAATTCCTTCAGACATACGCTCAGCAGCTCTCTGT
CTCCTTTCAACACTGCCCGTGCCGCTACTGATGCGTTATATCTATCCTCGGCTCTACTCCTTGCATGATATGCCG
GACAATGCCGGCATCCCCGACGAGGAAACGGGACAGATTGTCCTGCCATCGCCCCTTAATTTGACATCGGAGCGT
TTCGTATCGTATGGGCTCTACTTGATTGACGATGGACAGACGCAGTTCTTGTGGATTGGCCGCGATGCGGTGCCT
CAGCTCATATCCGATGTATTTGGCGTCGAGGACAGAACCCAGGTACACGTGGGCAAAGGGCGGGTTCCCGAACTC
GACAATGATTTCAATGAGCGAGTCAGGGCCGTCATTCAAAAAAGCCGTGACCATCGATCCCTTGGCGTGGGTAGC
ATTACAGTTCCACACCTATATATTGTCCGCGAGGATGGGGAGCCGAGCCTGAAGCTCTGGGCTCAAACACTCCTG
GTGGAGGATCGGGCTGACCAGAGTCTAAGCTCTGCCCAGTGGCTGGGCGTCTTGAGAGAAAAGGTTGGTTAA
Gene >OphauB2|5150
ATGTCAGCGCCCGGTAGCGATGAGCTCGGCCATGTGGCTGGGCAACAGCAGCCAGAGCAGGCATTGGACGGCGTC
TCTGGCGCCACGGGATTGGGAAAGAAGAAGAAGCGGGGATACGCTGCGCAGGCGTTTGAGGTTGGCACTGGCCCC
AATGCTTCAATGACTGGGCAGATGGCATGCGCCTCTGTGCCTGTGCCCTATGGCTACTCGTCTGTGCAGCAAGCA
GGGCAACAGCAGCAAGCACAGTATGCGGATGCCCAGCAAGCTGCAAATGCCGATTCGCATGCAGGCGTCTTGGCT
GGCCAGCATGTCCAGCCTGCGCATCGAGCAAGCTATGCGCAGCCCGAGCAGTCGTATCCGCTGCCTGCTGGGGCC
GGTGTGGCTGGCATGACGCAGGGCATGGGCGCTATGCACCTGGGCGGCCAGGCTCAACAAGCGCCATCAAACATG
ACACCCTTGAATCAACTCTACCCAACCGACCTCATGAATCAGCCCTTTGCTGTGTCGGAGCTCGATTTGCCTCCG
CCCCCCATCATGCTGGCACCAAATGTGGGTTTTGCCTGTCCTTGTCCATGGTGTTGGCGCGTGTTGACCGCATGC
AGACGAGTGTGACGCCTTCGCCAGCTGCAAATTGCCCTCCACGCTATATCCGGTCAACCCTGAATGCTGTTCCAA
CCACAAACTCACTGCTCAAAAAGTCCAAGTTGCCCTTTGCCCTCATTGTGCAGCCCTACGGCTCCCTGCACGACG
ACGAGGACGACATAGCTGTCATTCAGGACCAAGTCATATCGCGCTGTCGCCGTTGCAGGACCTATATCAATCCCT
TTGTTACCTTTTTGGACCAGGGCCACCGCTGGAGATGCAACATGTGCAATCTCAGCAACGACGTTCCCTCAGCCT
TTGATTGGGACACGGCAGCTCAGCAGACGGTTGATCGCTGGCAGCGACATGAACTGAACCATGCTGTAGTAGAGT
TTGTCGCCCCTCAGGAGTACATGGTTCGCCCCCCACAGCCTCTGGTTTACCTTTTTCTCTTGGATGTGAGCTACG
CGGCCGTGTCTAACGGTCTGCTGGCCACGAGCGCACGCACTATACTCGACAGCCTCAATCGGATACCAAATGCCG
ACCGTCGCACCCGACTTGGCTTCTTGGCCGTCGACGCCAGCTTGCACTATTTTTCAATTCCCAAGGACCAAGATG
AAACCGCCGAAACGAGTATGCTCGTCGTCAGCGATCTTGACGAGCCCTTTTTGCCTGTGCCTCACGACCTTCTGG
TTCCTTTGAGCGAGAGTCGCCAAAGCATAGAAGGCTTCCTACAGAAGCTTCCCGACATGTTTCACAACAACCAGA
GCAATGGCTCATGTATGGGCTCGGCTCTACGCGCCGGCCATAAGCTCATATCAGCTCTCGGCGGCAAGATTGTCC
TTCTCACTGCCTCTCTCCCCAACATTGGAGCTGGAAAGTTGGACATGCGAGAGGACAAGAAGCTGTTGGGTACTT
CCAAGGAAGGCAGTCTTTTGCAGACTGGAAGCAGCTTCTACAAGAGCTTTGCTGTCGAGTGTTCCAAGAGTCAAG
TTTCAATCGACATGTTTCTCTTTTCTTCCCACTATCAGGATGTTGCATCTCTCAGCAACTTGCCGAGATATACAG
GCGGCCAAACCTGGTTTTACCCTGGCTGGCACGCCTCTCGACCCGAAGACGCTCTCAAGTTTGCGTCCGAGTTGA
GCGACTACTTGTCATCTGAAATTGGGCTAGAAGCTGTGCTACGTGTCCGTGCCACGACTGGCCTACGCATGAGCG
CCTTTTATGGCAACTTTTTCAATCGCAGCTCCGATCTCTGCGCCTTTCCAGCCTTTCCCCGAGACCAATGCTACG
TGGTCGAGGTGGCCATGGATGAAAACATGACCAAAAACACTGTCTGTCTCCAAGCAGCTGTGCTACACACAACGT
GTAATGGTGAGCGCCGCATCCGGGTCCTCACCTTGTGTCTACCCACAACGACAAGTCTATCAGATGTCTTTGCGT
CGGCAGATCAATGTGCCATTACTACCTATTTCAGCCACAAGGCTGTCGAGAGGACTTTGAGTAGTGGCTTGGAGG
CTGCCCGCGACGCTCTTCAGGCCAAGCTTACCGAACTGCTCCAGACCTTCAAAAAGGAGCTGGCTGGTGGGAGTA
TGGGCGCCGGCTTGCAGTTTCCTGCCAATCTTCGCGGCCTGCCGTCTCTCTTTCTAGGCTTGATCAAGAATGTTG
GCTTACGCAAATCGGCGCAAATTCCTTCAGACATACGCTCAGCAGCTCTCTGTCTCCTTTCAACACTGCCCGTGC
CGCTACTGATGCGTTATATCTATCCTCGGCTCTACTCCTTGCATGATATGCCGGACAATGCCGGCATCCCCGACG
AGGAAACGGGACAGATTGTCCTGCCATCGCCCCTTAATTTGACATCGGAGCGTTTCGTATCGTATGGGCTCTACT
TGATTGACGATGGACAGACGCAGTTCTTGTGGATTGGCCGCGATGCGGTGCCTCAGCTCATATCCGATGTATTTG
GCGTCGAGGACAGAACCCAGGTACACGTGGGCAAAGGGCGGGTTCCCGAACTCGACAATGATTTCAATGAGCGAG
TCAGGGCCGTCATTCAAAAAAGCCGTGACCATCGATCCCTTGGCGTGGGTAGCATTACAGTTCCACACCTATATA
TTGTCCGCGAGGATGGGGAGCCGAGCCTGAAGCTCTGGGCTCAAACACTCCTGGTGGAGGATCGGGCTGACCAGA
GTCTAAGCTCTGCCCAGTGGCTGGGCGTCTTGAGAGAAAAGGTTGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail