Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5148
Gene name
LocationContig_385:2320..3941
Strand-
Gene length (bp)1621
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03105 SPX SPX domain 1.4E-48 1 316
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.7E-08 351 389
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 3.4E-07 348 393
PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING 4.3E-07 351 389
PF13639 zf-RING_2 Ring finger domain 2.8E-06 351 390
PF13445 zf-RING_UBOX RING-type zinc-finger 2.2E-05 351 387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14212|YDT7_SCHPO Uncharacterized RING finger protein C6B12.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6B12.07c PE=3 SV=2 1 446 9.0E-81
sp|Q5A1M4|TRY3_CANAL Transcriptional regulator of yeast form adherence 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY3 PE=2 SV=1 1 446 4.0E-74
sp|Q2TBT8|RN151_BOVIN RING finger protein 151 OS=Bos taurus GN=RNF151 PE=2 SV=1 342 396 2.0E-07
sp|Q2KHN1|RN151_HUMAN RING finger protein 151 OS=Homo sapiens GN=RNF151 PE=2 SV=1 344 393 4.0E-07
sp|Q9CQ29|RN151_MOUSE RING finger protein 151 OS=Mus musculus GN=Rnf151 PE=1 SV=1 344 396 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14212|YDT7_SCHPO Uncharacterized RING finger protein C6B12.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6B12.07c PE=3 SV=2 1 446 9.0E-81
sp|Q5A1M4|TRY3_CANAL Transcriptional regulator of yeast form adherence 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY3 PE=2 SV=1 1 446 4.0E-74
sp|Q2TBT8|RN151_BOVIN RING finger protein 151 OS=Bos taurus GN=RNF151 PE=2 SV=1 342 396 2.0E-07
sp|Q2KHN1|RN151_HUMAN RING finger protein 151 OS=Homo sapiens GN=RNF151 PE=2 SV=1 344 393 4.0E-07
sp|Q9CQ29|RN151_MOUSE RING finger protein 151 OS=Mus musculus GN=Rnf151 PE=1 SV=1 344 396 5.0E-07
sp|Q9CQE0|RN138_MOUSE E3 ubiquitin-protein ligase RNF138 OS=Mus musculus GN=Rnf138 PE=2 SV=1 335 409 5.0E-07
sp|Q8WVD3|RN138_HUMAN E3 ubiquitin-protein ligase RNF138 OS=Homo sapiens GN=RNF138 PE=1 SV=1 348 409 7.0E-07
sp|Q95153|BRCA1_CANLF Breast cancer type 1 susceptibility protein homolog OS=Canis lupus familiaris GN=BRCA1 PE=3 SV=1 330 397 1.0E-06
sp|Q32LN5|RN138_BOVIN E3 ubiquitin-protein ligase RNF138 OS=Bos taurus GN=RNF138 PE=2 SV=1 335 409 2.0E-06
sp|Q99PD2|RN138_RAT E3 ubiquitin-protein ligase RNF138 OS=Rattus norvegicus GN=Rnf138 PE=2 SV=1 335 399 3.0E-06
sp|Q9BZY9|TRI31_HUMAN E3 ubiquitin-protein ligase TRIM31 OS=Homo sapiens GN=TRIM31 PE=1 SV=2 348 412 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5148
MKFAHDFKATLASQGFPPHWVNRAIPYGQLKKCLKKVQRELEDLGLDAQTLRALLDPHTTSPVALQYRLRAASNS
NFVRPKLTLYLHLQDGVAVDASLTPTSRCFFERIVAEMTIHDNRIACDQSSVSSNILQDADDAEPLSTIVTLNYD
RIEVPLVFDGEFFSLLQNDVISLDALQTEEEQKITSEVVALGNNVSHVSRPSRFSKSDLGRWRRIFELYINAQIF
FATNERDHGVRSSVKALEQLRWFQNEVDKRELATSFNLGKSKLAFSKFLVLNANLLKNLQFQELNKLAVSKILKK
FDKRTALSVSQTFPTVIQSEGLLSRDLAKDMCAHLSEQLVAVVPQLSDFLCPICFAVAYRPVRLDCQHIFCIRCV
VKIQRRQESTCPLCRAHVVMRASADNLDEKLRRFLKKYFPEEVKEKQRANEIERGIEEYGPGYKHQDCVIM*
Coding >OphauB2|5148
ATGAAGTTTGCTCACGACTTTAAAGCAACACTGGCCAGCCAAGGCTTCCCTCCTCACTGGGTGAATCGTGCAATT
CCATATGGCCAACTAAAGAAATGTCTTAAAAAGGTACAGCGAGAACTCGAGGATCTCGGCCTCGACGCTCAAACG
CTACGCGCGCTCCTCGACCCTCATACAACATCACCCGTTGCGCTACAATATAGGCTCAGAGCGGCTAGTAACTCT
AACTTCGTTCGACCAAAGCTCACCCTGTACCTTCATCTACAGGATGGAGTCGCAGTCGACGCCTCCCTCACGCCC
ACGTCACGCTGCTTTTTTGAGCGAATTGTTGCCGAAATGACTATACATGACAATAGAATAGCTTGCGATCAGTCT
TCAGTGTCTAGCAATATCTTGCAAGACGCTGATGATGCTGAACCCTTATCCACGATAGTAACGCTCAACTATGAC
AGAATCGAGGTACCACTTGTTTTCGACGGCGAGTTTTTCAGCTTACTACAAAATGATGTCATTAGCCTTGATGCT
CTGCAGACCGAGGAGGAACAGAAAATTACGTCCGAGGTAGTGGCTTTAGGAAACAATGTTTCGCATGTTTCACGC
CCCAGCCGCTTCTCTAAGAGCGACCTTGGCCGTTGGCGCCGCATTTTCGAACTCTATATTAACGCACAAATTTTC
TTCGCCACCAATGAACGTGACCATGGAGTCAGATCTAGTGTCAAGGCCCTTGAGCAACTGCGTTGGTTTCAAAAC
GAAGTGGACAAGCGAGAGCTCGCTACCAGTTTTAATCTAGGCAAAAGCAAACTAGCCTTTTCCAAATTTCTAGTT
CTAAATGCCAATTTGCTCAAGAATCTACAATTCCAGGAGCTCAATAAGCTGGCCGTTTCCAAAATCCTCAAGAAA
TTCGACAAGAGAACGGCTCTTAGTGTCTCGCAAACTTTTCCAACAGTAATTCAATCCGAAGGCCTCTTGTCACGA
GACCTGGCTAAGGACATGTGTGCCCATTTATCGGAGCAACTAGTCGCTGTTGTTCCCCAACTCAGTGATTTCCTC
TGCCCAATATGCTTCGCAGTCGCCTATCGGCCAGTACGGCTTGATTGTCAGCACATTTTTTGCATCCGCTGCGTC
GTCAAAATCCAGCGGAGACAAGAAAGTACTTGTCCTCTATGCCGAGCCCATGTGGTCATGAGGGCTTCGGCTGAT
AACTTGGACGAGAAATTGCGAAGGTTTTTGAAAAAATATTTCCCCGAAGAGGTTAAGGAAAAGCAACGTGCCAAC
GAAATTGAACGCGGGATAGAAGAATATGGCCCTGGATACAAACATCAAGACTGTGTCATCATGTAG
Transcript >OphauB2|5148
ATGAAGTTTGCTCACGACTTTAAAGCAACACTGGCCAGCCAAGGCTTCCCTCCTCACTGGGTGAATCGTGCAATT
CCATATGGCCAACTAAAGAAATGTCTTAAAAAGGTACAGCGAGAACTCGAGGATCTCGGCCTCGACGCTCAAACG
CTACGCGCGCTCCTCGACCCTCATACAACATCACCCGTTGCGCTACAATATAGGCTCAGAGCGGCTAGTAACTCT
AACTTCGTTCGACCAAAGCTCACCCTGTACCTTCATCTACAGGATGGAGTCGCAGTCGACGCCTCCCTCACGCCC
ACGTCACGCTGCTTTTTTGAGCGAATTGTTGCCGAAATGACTATACATGACAATAGAATAGCTTGCGATCAGTCT
TCAGTGTCTAGCAATATCTTGCAAGACGCTGATGATGCTGAACCCTTATCCACGATAGTAACGCTCAACTATGAC
AGAATCGAGGTACCACTTGTTTTCGACGGCGAGTTTTTCAGCTTACTACAAAATGATGTCATTAGCCTTGATGCT
CTGCAGACCGAGGAGGAACAGAAAATTACGTCCGAGGTAGTGGCTTTAGGAAACAATGTTTCGCATGTTTCACGC
CCCAGCCGCTTCTCTAAGAGCGACCTTGGCCGTTGGCGCCGCATTTTCGAACTCTATATTAACGCACAAATTTTC
TTCGCCACCAATGAACGTGACCATGGAGTCAGATCTAGTGTCAAGGCCCTTGAGCAACTGCGTTGGTTTCAAAAC
GAAGTGGACAAGCGAGAGCTCGCTACCAGTTTTAATCTAGGCAAAAGCAAACTAGCCTTTTCCAAATTTCTAGTT
CTAAATGCCAATTTGCTCAAGAATCTACAATTCCAGGAGCTCAATAAGCTGGCCGTTTCCAAAATCCTCAAGAAA
TTCGACAAGAGAACGGCTCTTAGTGTCTCGCAAACTTTTCCAACAGTAATTCAATCCGAAGGCCTCTTGTCACGA
GACCTGGCTAAGGACATGTGTGCCCATTTATCGGAGCAACTAGTCGCTGTTGTTCCCCAACTCAGTGATTTCCTC
TGCCCAATATGCTTCGCAGTCGCCTATCGGCCAGTACGGCTTGATTGTCAGCACATTTTTTGCATCCGCTGCGTC
GTCAAAATCCAGCGGAGACAAGAAAGTACTTGTCCTCTATGCCGAGCCCATGTGGTCATGAGGGCTTCGGCTGAT
AACTTGGACGAGAAATTGCGAAGGTTTTTGAAAAAATATTTCCCCGAAGAGGTTAAGGAAAAGCAACGTGCCAAC
GAAATTGAACGCGGGATAGAAGAATATGGCCCTGGATACAAACATCAAGACTGTGTCATCATGTAG
Gene >OphauB2|5148
ATGAAGTTTGCTCACGACTTTAAAGCAACACTGGCCAGCCAAGGTGAAATAAGCCAATAATAGTCGTTCATCCTT
ATATTATACATACGATGCATGCGCATCTTGTCTAATACGAACCGCAGGCTTCCCTCCTCACTGGGTGAATCGTGC
AATTCCATATGGCCAACTAAAGAAATGTCTTAAAAAGGTACAGCGAGAACTCGAGGATCTCGGCCTCGACGCTCA
AACGCTACGCGCGCTCCTCGACCCTCATACAACATCACCCGTTGCGCTACAATATAGGCTCAGAGGTACGCACTG
CGTTCCATCATCCCCACACTCATGCTCCAATAATTACTGATGTAGACTGAAGCGGCTAGTAACTCTAACTTCGTT
CGACCAAAGCTCACCCTGTACCTTCATCTACAGGATGGAGTCGCAGTCGACGCCTCCCTCACGCCCACGTCACGC
TGCTTTTTTGAGCGAATTGTTGCCGAAATGACTATACATGACAATAGAATAGCTTGCGATCAGTCTTCAGTGTCT
AGCAATATCTTGCAAGACGCTGATGATGCTGAACCCTTATCCACGATAGTAACGCTCAACTATGACAGAATCGAG
GTACCACTTGTTTTCGACGGCGAGTTTTTCAGCTTACTACAAAATGATGTCATTAGCCTTGATGCTCTGCAGACC
GAGGAGGAACAGAAAATTACGTCCGAGGTAGTGGCTTTAGGAAACAATGTTTCGCATGTTTCACGCCCCAGCCGC
TTCTCTAAGAGCGACCTTGGCCGTTGGCGCCGCATTTTCGAACTCTATATTAACGCACAAATTTTCTTCGCCACC
AATGAACGTGACCATGGAGTCAGATCTAGTGTCAAGGCCCTTGAGCAACTGCGTTGGTTTCAAAACGAAGTGGAC
AAGCGAGAGCTCGCTACCAGTTTTAATCTAGGCAAAAGCAAACTAGCCTTTTCCAAATTTCTAGTTCTAAATGCC
AATTTGCTCAAGAATCTACAATTCCAGGAGCTCAATAAGCTGGCCGTTTCCAAAATCCTCAAGAGTACGCTCTTA
TCACGTCTATAAACCCAATCTTGGGTAGTCAGTCAACTAATAATCATGGACAGAATTCGACAAGAGAACGGCTCT
TAGTGTCTCGCAAACTTTTCCAACAGTAATTCAATCCGAAGGCCTCTTGTCACGAGACCTGGCTAAGGACATGTG
TGCCCATTTATCGGAGCAACTAGTCGCTGTTGTTCCCCAACTCAGTGATTTCCTCTGCCCAATATGCTTCGCAGT
CGCCTATCGGCCAGTACGGCTTGATTGTCAGCACATTTTTTGCATCCGCTGCGTCGTCAAAATCCAGCGGAGACA
AGAAAGTACTTGTCCTCTATGCCGAGCCCATGTGGTCATGAGGGCTTCGGCTGGTATGACCATGATTAATCGTAT
ATCTGGTTTCACACTGACCTTTGCTAACCAGTATGAGGTTTCTTGTTATGCAGATAACTTGGACGAGAAATTGCG
AAGGTTTTTGAAAAAATATTTCCCCGAAGAGGTTAAGGAAAAGCAACGTGCCAACGAAATTGAACGCGGGATAGA
AGAATATGGCCCTGGATACAAACATCAAGACTGTGTCATCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail