Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5147
Gene name
LocationContig_385:143..2035
Strand+
Gene length (bp)1892
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 6.2E-32 264 578

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38675|MET7_NEUCR Cystathionine gamma-synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-7 PE=3 SV=3 1 582 0.0E+00
sp|O74314|MET7_SCHPO Probable cystathionine gamma-synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.09c PE=3 SV=1 2 578 2.0E-180
sp|P47164|MET7_YEAST Cystathionine gamma-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STR2 PE=1 SV=1 5 581 2.0E-131
sp|Q12198|METW_YEAST Putative cystathionine gamma-synthase YLL058W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL058W PE=1 SV=1 1 583 4.0E-98
sp|Q04533|METX_YEAST Putative cystathionine gamma-synthase YML082W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML082W PE=1 SV=1 262 578 6.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38675|MET7_NEUCR Cystathionine gamma-synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-7 PE=3 SV=3 1 582 0.0E+00
sp|O74314|MET7_SCHPO Probable cystathionine gamma-synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.09c PE=3 SV=1 2 578 2.0E-180
sp|P47164|MET7_YEAST Cystathionine gamma-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STR2 PE=1 SV=1 5 581 2.0E-131
sp|Q12198|METW_YEAST Putative cystathionine gamma-synthase YLL058W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL058W PE=1 SV=1 1 583 4.0E-98
sp|Q04533|METX_YEAST Putative cystathionine gamma-synthase YML082W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML082W PE=1 SV=1 262 578 6.0E-79
sp|Q04533|METX_YEAST Putative cystathionine gamma-synthase YML082W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML082W PE=1 SV=1 5 271 2.0E-22
sp|O05394|MCCB_BACSU Cystathionine gamma-lyase OS=Bacillus subtilis (strain 168) GN=mccB PE=1 SV=1 266 578 4.0E-20
sp|Q1M0P5|METB_HELPX Cystathionine gamma-synthase OS=Helicobacter pylori GN=metB PE=1 SV=1 270 578 2.0E-17
sp|P00935|METB_ECOLI Cystathionine gamma-synthase OS=Escherichia coli (strain K12) GN=metB PE=1 SV=1 324 572 4.0E-17
sp|P55217|CGS1_ARATH Cystathionine gamma-synthase 1, chloroplastic OS=Arabidopsis thaliana GN=CGS1 PE=1 SV=3 321 578 4.0E-17
sp|Q9ZMW7|METB_HELPJ Cystathionine gamma-synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=metB PE=3 SV=1 303 570 1.0E-16
sp|P56069|METB_HELPY Cystathionine gamma-synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=metB PE=1 SV=1 270 570 4.0E-16
sp|A2RM21|METC_LACLM Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metC PE=1 SV=1 303 578 2.0E-15
sp|P0A4K2|METC_LACLA Cystathionine beta-lyase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metC PE=3 SV=1 303 578 2.0E-15
sp|P0C2T9|METC_LACLC Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris GN=metC PE=1 SV=1 296 578 4.0E-15
sp|P46807|METB_MYCLE Cystathionine gamma-synthase OS=Mycobacterium leprae (strain TN) GN=metB PE=3 SV=1 321 578 3.0E-14
sp|P13254|MEGL_PSEPU Methionine gamma-lyase OS=Pseudomonas putida GN=mdeA PE=1 SV=2 321 578 7.0E-14
sp|P66876|METB_MYCBO Cystathionine gamma-synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=metB PE=3 SV=1 335 579 2.0E-13
sp|P9WGB7|METB_MYCTU Cystathionine gamma-synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metB PE=1 SV=1 335 579 2.0E-13
sp|P9WGB6|METB_MYCTO Cystathionine gamma-synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metB PE=3 SV=1 335 579 2.0E-13
sp|Q83A83|METC_COXBU Cystathionine beta-lyase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metC PE=1 SV=1 324 565 4.0E-13
sp|Q55DV9|CGL_DICDI Cystathionine gamma-lyase OS=Dictyostelium discoideum GN=cysA PE=1 SV=1 315 578 1.0E-12
sp|P9WGB5|METZ_MYCTU O-succinylhomoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metZ PE=1 SV=1 270 578 1.0E-12
sp|P9WGB4|METZ_MYCTO O-succinylhomoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metZ PE=3 SV=1 270 578 1.0E-12
sp|O31632|METC_BACSU Cystathionine beta-lyase MetC OS=Bacillus subtilis (strain 168) GN=metC PE=1 SV=1 266 578 1.0E-11
sp|Q9C876|CGS2_ARATH Probable cystathionine gamma-synthase 2 OS=Arabidopsis thaliana GN=CGS2 PE=3 SV=1 305 578 2.0E-11
sp|P24601|METB_HERAU Probable cystathionine gamma-synthase (Fragment) OS=Herpetosiphon aurantiacus GN=metB PE=3 SV=1 339 511 5.0E-11
sp|Q19QT7|CGL_PIG Cystathionine gamma-lyase OS=Sus scrofa GN=CTH PE=2 SV=1 339 581 1.0E-10
sp|Q92441|MET17_KLULA Protein MET17 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MET17 PE=3 SV=3 334 587 1.0E-09
sp|O31631|METI_BACSU Cystathionine gamma-synthase/O-acetylhomoserine (thiol)-lyase OS=Bacillus subtilis (strain 168) GN=metI PE=1 SV=1 268 578 3.0E-09
sp|P55216|CGL2_CAEEL Putative cystathionine gamma-lyase 2 OS=Caenorhabditis elegans GN=cth-2 PE=3 SV=1 321 581 7.0E-09
sp|P44502|METB_HAEIN Cystathionine gamma-synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metB PE=3 SV=1 338 578 1.0E-08
sp|O13326|CYSD_SCHPO O-acetylhomoserine (thiol)-lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.11 PE=2 SV=1 324 581 2.0E-08
sp|P18757|CGL_RAT Cystathionine gamma-lyase OS=Rattus norvegicus GN=Cth PE=1 SV=2 339 581 2.0E-08
sp|Q60HG7|CGL_MACFA Cystathionine gamma-lyase OS=Macaca fascicularis GN=CTH PE=2 SV=1 339 581 7.0E-08
sp|Q8VCN5|CGL_MOUSE Cystathionine gamma-lyase OS=Mus musculus GN=Cth PE=1 SV=1 339 581 1.0E-07
sp|P53780|METC_ARATH Cystathionine beta-lyase, chloroplastic OS=Arabidopsis thaliana GN=At3g57050 PE=1 SV=1 327 570 1.0E-07
sp|P55218|METZ_PSEAE O-succinylhomoserine sulfhydrylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metZ PE=1 SV=1 339 578 7.0E-07
sp|Q07703|METC_BORAV Cystathionine beta-lyase OS=Bordetella avium GN=metC PE=1 SV=3 233 578 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019346 transsulfuration Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0043436 oxoacid metabolic process No
GO:0019842 vitamin binding No
GO:0006790 sulfur compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0000096 sulfur amino acid metabolic process No
GO:0003674 molecular_function No
GO:1901605 alpha-amino acid metabolic process No
GO:0006534 cysteine metabolic process No
GO:0043167 ion binding No
GO:0006520 cellular amino acid metabolic process No
GO:0050667 homocysteine metabolic process No
GO:0009069 serine family amino acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0070279 vitamin B6 binding No
GO:0044238 primary metabolic process No
GO:0009092 homoserine metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5147
MPIFSLGQSIPPDTAHAVSVSLPTWQSNIGYEEGQEWVMSRLTTGYPRFFIHRSIDAFACDIAAAHHIPGRRAML
FPTSAAAQRCLDYVAKHAPSHLVTDLDLIHLVLNSSATASALLQRLAPTVSAIMLPYDAFPFAKEYWQHTGDGIS
SRRAEFCHDLYAHHLLVATHVAALDCLVEERPSRGPKRYQQRPPCSSLSIATSSPPTTIETIESCRFLEERFGRN
LDLTMTERARSALRRRIAGSLTGSLPRQQSASHSLDESHVYLFPAGMNAIFNTHRALLLARGSLPSISFGFPYVD
SLKILQKFGPGCVFYGYSSSSDLDNLELRLHAGERYLALFCEFPGNPLLTSPDLDRIRNLADKFDFAVIVDETIG
TFANVNVLPVADIVVSSLTKIFSGDSNVMGGCAILNPDSKYYSSLKTAMEGGIFEDTYWPEDLVFLERNSRDFMD
RVGRINTNAEAICHVLNHHPLVKDIYYPKYSSSRHHYDARRLPNGGYGGLLSIVFKHKKQAQVFYDAMESAKGPS
LGTNFTLCSPYALLAHYRELPWAAKYGVDPDLVRVSVGLEDSEMLQAMFRKALGVAEAIQIP*
Coding >OphauB2|5147
ATGCCTATATTTTCTCTTGGACAATCTATTCCGCCCGATACGGCCCATGCTGTGAGCGTGTCGCTGCCAACATGG
CAGTCCAATATTGGCTATGAAGAAGGTCAAGAATGGGTTATGAGCCGGTTGACCACAGGCTATCCCCGCTTCTTC
ATCCACCGCAGCATAGATGCTTTTGCGTGCGACATTGCTGCGGCACATCACATACCGGGCCGCCGGGCAATGCTC
TTTCCAACCTCGGCCGCGGCGCAACGATGTTTAGATTACGTTGCCAAGCACGCTCCCTCGCACCTTGTCACCGAC
CTCGATCTTATTCACCTGGTCTTGAACTCCTCGGCAACCGCATCGGCGCTACTTCAAAGGCTGGCGCCCACGGTG
TCCGCCATCATGCTGCCATATGACGCCTTTCCTTTTGCCAAGGAATACTGGCAGCATACTGGTGATGGTATCTCA
AGTCGTAGAGCCGAGTTCTGTCACGATCTCTACGCTCATCACTTACTCGTTGCTACCCATGTGGCTGCTTTGGAC
TGCCTAGTCGAGGAGCGACCATCGAGGGGCCCTAAGCGCTACCAACAGCGGCCTCCGTGCAGTTCTCTCTCCATT
GCAACCTCTTCGCCACCGACTACTATTGAAACAATTGAAAGCTGCCGCTTTCTTGAAGAGCGCTTCGGTCGAAAT
CTTGATCTCACAATGACAGAGCGCGCCCGGTCAGCGCTTCGCCGTCGCATCGCCGGGTCTCTCACTGGAAGCCTG
CCACGCCAGCAGAGCGCCTCACACAGCCTTGATGAGAGCCATGTCTACCTCTTTCCGGCAGGTATGAATGCCATC
TTCAATACTCATCGTGCTTTGCTCTTGGCTAGAGGTTCGCTTCCGAGCATCAGCTTTGGCTTTCCATACGTTGAT
AGTCTCAAAATTCTCCAAAAGTTTGGCCCGGGCTGCGTCTTCTATGGCTATTCCTCGTCGAGCGATCTTGACAAT
CTCGAGCTTCGTCTCCATGCCGGAGAGCGCTATCTTGCCCTTTTTTGCGAATTTCCTGGAAATCCACTTCTTACA
AGTCCCGACTTGGACCGCATCCGCAACCTTGCTGACAAGTTCGATTTTGCTGTCATTGTCGACGAAACTATCGGC
ACTTTTGCTAATGTGAATGTGCTCCCTGTGGCCGACATTGTTGTCAGCAGCCTCACAAAGATATTTTCAGGTGAC
TCCAATGTCATGGGCGGCTGTGCTATTCTCAACCCCGACAGCAAGTACTACAGTTCACTCAAGACTGCCATGGAA
GGTGGCATATTTGAGGATACGTACTGGCCTGAAGACCTGGTTTTTCTGGAGAGAAATAGCCGCGACTTCATGGAC
CGTGTTGGTCGCATCAATACCAATGCAGAAGCTATTTGTCATGTTCTCAACCATCATCCGCTCGTCAAGGACATA
TACTATCCTAAATATAGCTCCTCTAGGCACCACTACGACGCTCGTCGTCTGCCAAATGGGGGCTATGGCGGCCTC
TTATCCATTGTATTCAAGCACAAGAAGCAGGCACAGGTGTTTTATGATGCCATGGAAAGCGCTAAAGGGCCTAGC
CTGGGAACCAATTTCACCCTATGTTCACCATATGCCCTACTCGCACACTATCGCGAACTTCCTTGGGCAGCTAAG
TATGGAGTTGATCCCGACCTTGTCCGCGTCAGCGTGGGACTTGAAGATTCTGAAATGCTCCAGGCGATGTTTCGC
AAAGCACTCGGGGTCGCCGAGGCTATACAAATACCTTGA
Transcript >OphauB2|5147
ATGCCTATATTTTCTCTTGGACAATCTATTCCGCCCGATACGGCCCATGCTGTGAGCGTGTCGCTGCCAACATGG
CAGTCCAATATTGGCTATGAAGAAGGTCAAGAATGGGTTATGAGCCGGTTGACCACAGGCTATCCCCGCTTCTTC
ATCCACCGCAGCATAGATGCTTTTGCGTGCGACATTGCTGCGGCACATCACATACCGGGCCGCCGGGCAATGCTC
TTTCCAACCTCGGCCGCGGCGCAACGATGTTTAGATTACGTTGCCAAGCACGCTCCCTCGCACCTTGTCACCGAC
CTCGATCTTATTCACCTGGTCTTGAACTCCTCGGCAACCGCATCGGCGCTACTTCAAAGGCTGGCGCCCACGGTG
TCCGCCATCATGCTGCCATATGACGCCTTTCCTTTTGCCAAGGAATACTGGCAGCATACTGGTGATGGTATCTCA
AGTCGTAGAGCCGAGTTCTGTCACGATCTCTACGCTCATCACTTACTCGTTGCTACCCATGTGGCTGCTTTGGAC
TGCCTAGTCGAGGAGCGACCATCGAGGGGCCCTAAGCGCTACCAACAGCGGCCTCCGTGCAGTTCTCTCTCCATT
GCAACCTCTTCGCCACCGACTACTATTGAAACAATTGAAAGCTGCCGCTTTCTTGAAGAGCGCTTCGGTCGAAAT
CTTGATCTCACAATGACAGAGCGCGCCCGGTCAGCGCTTCGCCGTCGCATCGCCGGGTCTCTCACTGGAAGCCTG
CCACGCCAGCAGAGCGCCTCACACAGCCTTGATGAGAGCCATGTCTACCTCTTTCCGGCAGGTATGAATGCCATC
TTCAATACTCATCGTGCTTTGCTCTTGGCTAGAGGTTCGCTTCCGAGCATCAGCTTTGGCTTTCCATACGTTGAT
AGTCTCAAAATTCTCCAAAAGTTTGGCCCGGGCTGCGTCTTCTATGGCTATTCCTCGTCGAGCGATCTTGACAAT
CTCGAGCTTCGTCTCCATGCCGGAGAGCGCTATCTTGCCCTTTTTTGCGAATTTCCTGGAAATCCACTTCTTACA
AGTCCCGACTTGGACCGCATCCGCAACCTTGCTGACAAGTTCGATTTTGCTGTCATTGTCGACGAAACTATCGGC
ACTTTTGCTAATGTGAATGTGCTCCCTGTGGCCGACATTGTTGTCAGCAGCCTCACAAAGATATTTTCAGGTGAC
TCCAATGTCATGGGCGGCTGTGCTATTCTCAACCCCGACAGCAAGTACTACAGTTCACTCAAGACTGCCATGGAA
GGTGGCATATTTGAGGATACGTACTGGCCTGAAGACCTGGTTTTTCTGGAGAGAAATAGCCGCGACTTCATGGAC
CGTGTTGGTCGCATCAATACCAATGCAGAAGCTATTTGTCATGTTCTCAACCATCATCCGCTCGTCAAGGACATA
TACTATCCTAAATATAGCTCCTCTAGGCACCACTACGACGCTCGTCGTCTGCCAAATGGGGGCTATGGCGGCCTC
TTATCCATTGTATTCAAGCACAAGAAGCAGGCACAGGTGTTTTATGATGCCATGGAAAGCGCTAAAGGGCCTAGC
CTGGGAACCAATTTCACCCTATGTTCACCATATGCCCTACTCGCACACTATCGCGAACTTCCTTGGGCAGCTAAG
TATGGAGTTGATCCCGACCTTGTCCGCGTCAGCGTGGGACTTGAAGATTCTGAAATGCTCCAGGCGATGTTTCGC
AAAGCACTCGGGGTCGCCGAGGCTATACAAATACCTTGA
Gene >OphauB2|5147
ATGCCTATATTTTCTCTTGGACAATCTATTCCGCCCGATACGGCCCATGTCTGTGCCATGATGAAGCCCTCTTAC
TCTCTGCTTATCTAGCTAATATCTATACGTGAGAAAGGCTGTGAGCGTGTCGCTGCCAACATGGCAGTCCAATAT
TGGCTATGAAGAAGGTCAAGAATGGGTTATGAGCCGGTTGACCACAGGCTATCCCCGGTATAAGTCTACCATTTA
GTCTGCTTCTATTACTTGTGGTCTAATGTCACGTCCTGTCGTACAGCTTCTTCATCCACCGCAGCATAGATGCTT
TTGCGTGCGACATTGCTGCGGCACATCACATACCGGGCCGCCGGGCAATGCTCTTTCCAACCTCGGCCGCGGCGC
AACGATGTTTAGATTACGTTGCCAAGCACGCTCCCTCGCACCTTGTCACCGACCTCGATCTTATTCACCTGGTCT
TGAACTCCTCGGCAACCGCATCGGCGCTACTTCAAAGGCTGGCGCCCACGGTGTCCGCCATCATGCTGCCATATG
ACGCCTTTCCTTTTGCCAAGGAATACTGGCAGCATACTGGTGATGGTATCTCAAGTCGTAGAGCCGAGTTCTGTC
ACGATCTCTACGCTCATCACTTACTCGTTGCTACCCATGTGGCTGCTTTGGACTGCCTAGTCGAGGAGCGACCAT
CGAGGGGCCCTAAGCGCTACCAACAGCGGCCTCCGTGCAGTTCTCTCTCCATTGCAACCTCTTCGCCACCGACTA
CTATTGAAACAATTGAAAGCTGCCGCTTTCTTGAAGAGCGCTTCGGTCGAAATCTTGATCTCACAATGACAGAGC
GCGCCCGGTCAGCGCTTCGCCGTCGCATCGCCGGGTCTCTCACTGGAAGCCTGCCACGCCAGCAGAGCGCCTCAC
ACAGCCTTGATGAGAGCCATGTCTACCTCTTTCCGGCAGGTATGAATGCCATCTTCAATACTCATCGTGCTTTGC
TCTTGGCTAGAGGTTCGCTTCCGAGCATCAGCTTTGGCTTTCCATACGTTGATAGTCTCAAAATTCTCCAAAAGT
TTGGCCCGGGCTGCGTCTTCTATGGCTATTCCTCGTCGAGCGATCTTGACAATCTCGAGCTTCGTCTCCATGCCG
GAGAGCGCTATCTTGCCCTTTTTTGCGAATTTCCTGGAAATCCACTTCTTACAAGTCCCGACTTGGACCGCATCC
GCAACCTTGCTGACAAGTTCGATTTTGCTGTCATTGTCGACGAAACTATCGGCACTTTTGCTAATGTGAATGTGC
TCCCTGTGGCCGACATTGTTGTCAGCAGCCTCACAAAGATATTTTCAGGTGACTCCAATGTCATGGGCGGCTGTG
CTATTCTCAACCCCGACAGCAAGTACTACAGTTCACTCAAGACTGCCATGGAAGGTGGCATATTTGAGGATACGT
ACTGGCCTGAAGACCTGGTTTTTCTGGAGAGAAATAGCCGCGACTTCATGGACCGTGTTGGTCGCATCAATACCA
ATGCAGAAGCTATTTGTCATGTTCTCAACCATCATCCGCTCGTCAAGGACATATACTATCCTAAATATAGCTCCT
CTAGGCACCACTACGACGCTCGTCGTCTGCCAAATGGGGGCTATGGCGGCCTCTTATCCATTGTATTCAAGCACA
AGAAGCAGGCACAGGTGTTTTATGATGCCATGGAAAGCGCTAAAGGGCCTAGCCTGGGAACCAATTTCACCCTAT
GTTCACCATATGCCCTACTCGCACACTATCGCGAACTTCCTTGGGCAGCTAAGTATGGAGTTGATCCCGACCTTG
TCCGCGTCAGCGTGGGACTTGAAGATTCTGAAATGCTCCAGGCGATGTTTCGCAAAGCACTCGGGGTCGCCGAGG
CTATACAAATACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail