Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5145
Gene name
LocationContig_384:104..1308
Strand+
Gene length (bp)1204
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04114 Gaa1 Gaa1-like, GPI transamidase component 3.8E-71 120 286

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P39012|GAA1_YEAST GPI transamidase component GAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAA1 PE=1 SV=1 15 295 2.0E-53
sp|Q9US48|GAA1_SCHPO GPI transamidase component gaa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaa1 PE=3 SV=1 5 283 3.0E-48
sp|Q9WTK3|GPAA1_MOUSE Glycosylphosphatidylinositol anchor attachment 1 protein OS=Mus musculus GN=Gpaa1 PE=1 SV=3 24 250 2.0E-27
sp|O43292|GPAA1_HUMAN Glycosylphosphatidylinositol anchor attachment 1 protein OS=Homo sapiens GN=GPAA1 PE=1 SV=3 4 250 2.0E-25

GO

GO Term Description Terminal node
GO:0042765 GPI-anchor transamidase complex Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0032991 protein-containing complex No
GO:1905368 peptidase complex No
GO:0008303 caspase complex No
GO:0031224 intrinsic component of membrane No
GO:1902494 catalytic complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0005575 cellular_component No
GO:0098796 membrane protein complex No
GO:1905369 endopeptidase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5145
MSRLLSSALSLRRDPRMLKFPPYLSLLCITIGIAWLFLLPIENYSRRTYISENALLPGQVHTYFGGSEQNVFRAY
GQELEALADESNHYINDKLETMLEDVGIKVGRQNYTYHSAGQVYSGENLYGILQAPRGDATEALVLVAAWKSIEG
ELNRNGVALALTLVRYFRRWSLWSKDIILVVPPDSKIGTQAWVDAYHDAHDANCVASLPLKSGALQGAIAIDYTG
QQRFEGIHIIYDGTNGQLPNLDLINSIINIAGGQMGMQTVIQDMKHHTGRYSDRLKTMLRASLLTTWTLSRYNLM
AMDGMTRWQWAK*
Coding >OphauB2|5145
ATGTCACGGTTGCTTTCCTCTGCGTTGTCACTTCGCCGCGATCCACGGATGCTCAAATTTCCACCTTATCTATCC
CTGCTATGTATCACCATAGGCATCGCTTGGCTTTTCTTGTTGCCCATCGAGAACTACTCCCGTAGAACTTATATA
TCCGAAAATGCACTTCTTCCGGGCCAGGTACACACATACTTTGGTGGTAGCGAGCAGAATGTGTTCCGAGCATAC
GGCCAAGAACTGGAAGCACTGGCCGATGAAAGCAATCACTACATTAATGACAAACTCGAGACCATGCTCGAGGAC
GTTGGCATCAAAGTCGGGAGGCAAAATTACACTTACCACTCCGCCGGTCAGGTCTACTCTGGTGAAAATCTATAT
GGAATCCTACAAGCACCTCGAGGAGATGCAACCGAAGCCCTTGTCCTTGTTGCCGCATGGAAGAGCATCGAGGGC
GAGCTGAATCGCAATGGCGTGGCACTGGCATTGACATTGGTTCGCTATTTTAGACGTTGGTCTCTATGGTCCAAG
GATATAATCTTGGTGGTGCCTCCAGACAGCAAAATTGGAACCCAAGCCTGGGTTGATGCTTATCACGATGCTCAT
GATGCTAACTGTGTCGCCTCGTTACCCCTAAAATCTGGAGCTCTTCAGGGTGCCATTGCAATAGACTATACGGGG
CAGCAGCGATTCGAGGGCATTCATATCATCTACGACGGCACAAATGGGCAGCTCCCCAATCTCGACCTTATTAAT
TCTATCATTAATATTGCCGGCGGTCAGATGGGTATGCAAACGGTAATTCAAGATATGAAACATCATACGGGTCGT
TATTCGGATAGGCTCAAGACCATGCTCCGAGCTTCATTGCTTACCACGTGGACGCTGTCTCGTTACAACCTTATG
GCCATGGATGGCATGACGAGATGGCAATGGGCAAAGTAG
Transcript >OphauB2|5145
ATGTCACGGTTGCTTTCCTCTGCGTTGTCACTTCGCCGCGATCCACGGATGCTCAAATTTCCACCTTATCTATCC
CTGCTATGTATCACCATAGGCATCGCTTGGCTTTTCTTGTTGCCCATCGAGAACTACTCCCGTAGAACTTATATA
TCCGAAAATGCACTTCTTCCGGGCCAGGTACACACATACTTTGGTGGTAGCGAGCAGAATGTGTTCCGAGCATAC
GGCCAAGAACTGGAAGCACTGGCCGATGAAAGCAATCACTACATTAATGACAAACTCGAGACCATGCTCGAGGAC
GTTGGCATCAAAGTCGGGAGGCAAAATTACACTTACCACTCCGCCGGTCAGGTCTACTCTGGTGAAAATCTATAT
GGAATCCTACAAGCACCTCGAGGAGATGCAACCGAAGCCCTTGTCCTTGTTGCCGCATGGAAGAGCATCGAGGGC
GAGCTGAATCGCAATGGCGTGGCACTGGCATTGACATTGGTTCGCTATTTTAGACGTTGGTCTCTATGGTCCAAG
GATATAATCTTGGTGGTGCCTCCAGACAGCAAAATTGGAACCCAAGCCTGGGTTGATGCTTATCACGATGCTCAT
GATGCTAACTGTGTCGCCTCGTTACCCCTAAAATCTGGAGCTCTTCAGGGTGCCATTGCAATAGACTATACGGGG
CAGCAGCGATTCGAGGGCATTCATATCATCTACGACGGCACAAATGGGCAGCTCCCCAATCTCGACCTTATTAAT
TCTATCATTAATATTGCCGGCGGTCAGATGGGTATGCAAACGGTAATTCAAGATATGAAACATCATACGGGTCGT
TATTCGGATAGGCTCAAGACCATGCTCCGAGCTTCATTGCTTACCACGTGGACGCTGTCTCGTTACAACCTTATG
GCCATGGATGGCATGACGAGATGGCAATGGGCAAAGTAG
Gene >OphauB2|5145
ATGTCACGGTTGCTTTGTGAGCGAGCTATAGCATTTATTTGCTCTCCTGAAATACCTGCTTATGATTAGTGGTGT
AGCCTCTGCGTTGTCACTTCGCCGCGATCCACGGATGCTCAAATTTCCACCTTATCTATCCCTGCTATGTATCAC
CATAGGCATCGCTTGGCTTTTCTTGTTGCCCATCGAGAACTACTCCCGTAGAACTTATATATCCGAAAATGCACT
TCTTCCGGGCCAGGTACACACATACTTTGGTGGTAGCGAGCAGAATGTGTTCCGAGCATACGGCCAAGAACTGGA
AGCACTGGCCGATGAAAGCAATCACTAGTACGTCCGTCTCGAGCTCCAAACCAGCCAAAGATTATAGGGCATACA
AAAAATAGTTCATTGACTGATTGTCTCTCAGCATTAATGACAAACTCGAGACCATGCTCGAGGACGTTGGCATCA
AAGTCGGGAGGCAAAATTACACTTACCACTCCGCCGGTCAGGTCTACTCTGGTGAAAATCTATATGGAATCCTAC
AAGCACCTCGAGGAGATGCAACCGAAGCCCTTGTCCTTGTTGCCGCATGGAAGAGCATCGAGGGCGAGCTGAATC
GCAATGGCGTGGCACTGGCATTGACATTGGTTCGCTATTTTAGACGCAAGTTAATGAAGCTCAGTTGCCATTATT
AATGGCCGATGAATTTGAGGTTATCTACATACTAATTATAACTATACAGGTTGGTCTCTATGGTCCAAGGATATA
ATCTTGGTGGTGCCTCCAGACAGCAAAATTGGAACCCAAGCCTGGGTTGATGCTTATCACGATGCTCATGATGCT
AACTGTGTCGCCTCGTTACCCCTAAAATCTGGAGCTCTTCAGGGTGCCATTGCAATAGACTATACGGGGCAGCAG
CGATTCGAGGGCATTCATATCATCTACGACGGCACAAATGGGCAGCTCCCCAATCTCGACCTTATTAATTCTATC
ATTAATATTGCCGGCGGTCAGATGGGTATGCAAACGGTAATTCAAGATATGAAACATCATACGGGTCGTTATTCG
GATAGGCTCAAGACCATGCTCCGAGGTATGCTACATCAGGGTCTTGGTATTGCAGCTGGTCCACATAGTAGCTTC
ATTGCTTACCACGTGGACGCTGTCTCGTTACAACCTTATGGCCATGGATGGCATGACGAGATGGCAATGGGCAAA
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail