Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5139
Gene name
LocationContig_38:131953..132782
Strand-
Gene length (bp)829
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09430 EMC7_beta-sandw ER membrane protein complex subunit 7, beta-sandwich domain 1.1E-19 29 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0IHY5|EMC7_XENTR ER membrane protein complex subunit 7 OS=Xenopus tropicalis GN=emc7 PE=2 SV=1 49 171 6.0E-12
sp|Q9EP72|EMC7_MOUSE ER membrane protein complex subunit 7 OS=Mus musculus GN=Emc7 PE=1 SV=1 49 171 6.0E-12
sp|Q9NPA0|EMC7_HUMAN ER membrane protein complex subunit 7 OS=Homo sapiens GN=EMC7 PE=1 SV=1 49 171 8.0E-12
sp|A5PJA8|EMC7_BOVIN ER membrane protein complex subunit 7 OS=Bos taurus GN=EMC7 PE=2 SV=1 49 171 8.0E-12
sp|Q4R5V2|EMC7_MACFA ER membrane protein complex subunit 7 OS=Macaca fascicularis GN=EMC7 PE=2 SV=1 49 171 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0IHY5|EMC7_XENTR ER membrane protein complex subunit 7 OS=Xenopus tropicalis GN=emc7 PE=2 SV=1 49 171 6.0E-12
sp|Q9EP72|EMC7_MOUSE ER membrane protein complex subunit 7 OS=Mus musculus GN=Emc7 PE=1 SV=1 49 171 6.0E-12
sp|Q9NPA0|EMC7_HUMAN ER membrane protein complex subunit 7 OS=Homo sapiens GN=EMC7 PE=1 SV=1 49 171 8.0E-12
sp|A5PJA8|EMC7_BOVIN ER membrane protein complex subunit 7 OS=Bos taurus GN=EMC7 PE=2 SV=1 49 171 8.0E-12
sp|Q4R5V2|EMC7_MACFA ER membrane protein complex subunit 7 OS=Macaca fascicularis GN=EMC7 PE=2 SV=1 49 171 4.0E-11
sp|Q8VY97|Y4213_ARATH ER membrane protein complex subunit 7 homolog OS=Arabidopsis thaliana GN=At4g32130 PE=2 SV=1 55 179 8.0E-09
sp|Q5TYV0|EMC7_DANRE ER membrane protein complex subunit 7 OS=Danio rerio GN=emc7 PE=2 SV=1 49 171 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 141 158 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5139
MHLLMLLLMPLALCTIVKLHLPATPSPISLSSRTHATLSTLGTYLSAPLSAHNTIVFRNVTSGSYLVDVHCPSEA
YRPLRVDVAQDGSVTAWDTFRGNEWENLGEVVPVKNGALEVRWMGSRQYYLERPGFSVLGILKNPMILMGLVSML
IFIGMPYLMENMDPEMKAEFEAQQRKGGPMAAMMGGNAQAGNPLGDFDMAAFLAGSKKKEVAAPQTGEAASAPRE
QGVRR*
Coding >OphauB2|5139
ATGCATCTCCTCATGCTCCTCCTGATGCCCCTCGCGCTGTGCACGATAGTCAAGCTCCATCTTCCAGCAACGCCT
AGCCCTATATCGTTGTCGTCGCGTACGCACGCCACGCTATCCACTCTCGGTACCTACCTCAGTGCTCCTTTATCC
GCGCACAACACCATCGTCTTCCGCAACGTCACTTCCGGCTCATATCTGGTTGACGTACACTGCCCCAGCGAGGCC
TATCGACCGTTGCGCGTTGATGTGGCACAGGATGGCTCCGTGACTGCGTGGGACACGTTTCGTGGAAACGAGTGG
GAGAATCTGGGCGAGGTGGTGCCCGTCAAGAATGGAGCTCTCGAGGTGCGCTGGATGGGCAGCCGTCAGTATTAT
CTGGAGAGACCAGGCTTTTCTGTACTGGGCATTCTCAAGAATCCCATGATTCTCATGGGGCTGGTCAGCATGCTC
ATCTTTATCGGCATGCCATATCTCATGGAAAACATGGATCCCGAAATGAAGGCCGAGTTTGAAGCACAGCAACGC
AAGGGCGGGCCCATGGCTGCCATGATGGGTGGTAATGCACAGGCCGGCAACCCGCTAGGGGACTTTGACATGGCG
GCCTTTCTGGCCGGATCAAAGAAGAAAGAGGTTGCTGCGCCACAGACTGGAGAAGCGGCATCAGCACCCAGAGAG
CAGGGTGTCCGCAGATGA
Transcript >OphauB2|5139
ATGCATCTCCTCATGCTCCTCCTGATGCCCCTCGCGCTGTGCACGATAGTCAAGCTCCATCTTCCAGCAACGCCT
AGCCCTATATCGTTGTCGTCGCGTACGCACGCCACGCTATCCACTCTCGGTACCTACCTCAGTGCTCCTTTATCC
GCGCACAACACCATCGTCTTCCGCAACGTCACTTCCGGCTCATATCTGGTTGACGTACACTGCCCCAGCGAGGCC
TATCGACCGTTGCGCGTTGATGTGGCACAGGATGGCTCCGTGACTGCGTGGGACACGTTTCGTGGAAACGAGTGG
GAGAATCTGGGCGAGGTGGTGCCCGTCAAGAATGGAGCTCTCGAGGTGCGCTGGATGGGCAGCCGTCAGTATTAT
CTGGAGAGACCAGGCTTTTCTGTACTGGGCATTCTCAAGAATCCCATGATTCTCATGGGGCTGGTCAGCATGCTC
ATCTTTATCGGCATGCCATATCTCATGGAAAACATGGATCCCGAAATGAAGGCCGAGTTTGAAGCACAGCAACGC
AAGGGCGGGCCCATGGCTGCCATGATGGGTGGTAATGCACAGGCCGGCAACCCGCTAGGGGACTTTGACATGGCG
GCCTTTCTGGCCGGATCAAAGAAGAAAGAGGTTGCTGCGCCACAGACTGGAGAAGCGGCATCAGCACCCAGAGAG
CAGGGTGTCCGCAGATGA
Gene >OphauB2|5139
ATGCATCTCCTCATGCTCCTCCTGATGCCCCTCGCGCTGTGCACGATAGTCAAGCTCCATCTTCCAGCAACGCCT
AGCCCTATATCGTTGTCGTCGCGTACGCACGCCACGCTATCCACTCTCGGTACCTACCTCAGTGCTCCTTTATCC
GCGCACAACACCATCGTCTTCCGCAACGTCACTTCCGGCTCATATCTGGTTGACGTACACTGCCCCAGCGAGGCC
TATCGACCGTTGCGCGTTGATGTGGCACAGGATGGCTCCGTGACTGCGTGGGACACGTTTCGTGGAAACGAGTGG
GAGAATCTGGGCGAGGTGGTGCCCGTCAAGAATGGAGCTCTCGAGGTGCGCTGGATGGGCAGCCGTCAGTATTAT
CTGGAGAGACCAGGCTGTTAGATTGCTCCTTCTTGTCCTTGGCATGCGACGTTGCTAACGGCATATAGTTTCTGT
ACTGGGCATTCTCAAGAATCCCATGATTCTCATGGGGCTGGTCAGCATGCTCATCTTTATCGGCATGCCATATCT
CATGGAAAACAGTACGTCTTGTATACTCGAATCGGCGAAACCACATGGGATGGTGGAGGTGCAAGAGGGACTTGC
AACTCGCTGACGCTTCACAGTGGATCCCGAAATGAAGGCCGAGTTTGAAGCACAGCAACGCAAGGGCGGGCCCAT
GGCTGCCATGATGGGTGGTAATGCACAGGCCGGCAACCCGCTAGGGGACTTTGACATGGCGGCCTTTCTGGCCGG
ATCAAAGAAGAAAGAGGTTGCTGCGCCACAGACTGGAGAAGCGGCATCAGCACCCAGAGAGCAGGGTGTCCGCAG
ATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail