Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5137
Gene name
LocationContig_38:127275..129617
Strand+
Gene length (bp)2342
Transcript length (bp)2289
Coding sequence length (bp)2289
Protein length (aa) 763

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04515 Choline_transpo Plasma-membrane choline transporter 5.4E-30 410 733

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74441|CTL1_SCHPO Choline transporter-like protein ctl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctl1 PE=1 SV=1 185 761 3.0E-43

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 297 319 22
2 339 358 19
3 365 387 22
4 402 421 19
5 448 470 22
6 490 512 22
7 544 566 22
8 586 608 22
9 656 678 22
10 693 715 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5137
MFSEYASRFLAQSQSRFSTFGQADTDHAPQSTDWFSSRPGRPHRDTGRASRSLASRGYTGYQQHGNGSRFGNIGF
ASRISAAQDAPLFHGTLDEFREDDEEEREREAADMFALQRSRRVAAASQLLESTESANSHVSLEASAGQIDSPYT
VHGPGPSVKSSRSDARSSHRHHPRQNTLFQHAEQSSHSGRDVGSPMSKGNMVDVGLDSYLEGNDDPPESLLGEDA
LSDASPPPFQRLRPQSERTPFMLKGNSSQGRPSHSAQLPHTTHSEHTTPQESAQPSNTIVEGELFRHDPFFAWIY
MISFAAMMSTFVLVWLHTAPRKSPVGDTIYSTVQKSFDMLAVDTIVSVFVSLIWLAALRSFVRPLVSVILVAVPV
IMLSFSLYAFISSFKGSTHGSSFQDSIMRWASFLPAAACIVWLWLVVKGRRAIQQAIDILQFSSKILAQNPALLV
VGFCCLGLIIVWTWAWLVMFTRVFMGGYFSKSLIRFVIQLSSWWLGAAFVLMYLWTLAIINAVHRATTAATVSQW
YFHRNAGPVTPSKDIVLAALGHATSTVFGSICQSTLLALMIRAPLLFLPRRLGIGITNMAAFWMPTPIMALTSPL
TVTYSAIHSQNLATSARGLDQMEVISPTIPTTTLTPRALRSRGQYHGLIPYRLAKLLLVATRFIMATGLGFAGWV
ITAKQLRIQLPDGMGVRGSAYAYVVGLMASFIGYSVMGAVEGILSGIVDAVLVCYGSERRIERGHGRFCLEAAYL
FGERRVESDGYA*
Coding >OphauB2|5137
ATGTTTTCAGAGTATGCTTCTCGTTTTCTTGCTCAGTCTCAATCGCGATTTTCGACGTTTGGCCAAGCAGACACC
GACCACGCACCGCAATCCACCGATTGGTTCTCATCACGGCCCGGCCGTCCTCATAGAGACACTGGCCGGGCCAGT
AGGTCTCTTGCTTCCCGCGGCTACACCGGCTACCAGCAGCATGGCAATGGATCCCGCTTTGGCAATATCGGTTTT
GCCTCCCGCATATCGGCCGCCCAAGATGCGCCTCTCTTCCACGGCACGCTCGATGAGTTTCGAGAAGACGACGAG
GAGGAGAGGGAACGCGAGGCAGCCGACATGTTCGCACTGCAACGGTCTCGCCGCGTAGCTGCTGCGAGCCAACTA
CTCGAAAGCACCGAGTCGGCAAACAGCCACGTCTCACTTGAGGCGAGTGCTGGCCAAATTGACAGTCCATATACT
GTACATGGACCCGGACCAAGCGTCAAGAGCAGTCGCAGCGATGCTAGAAGCAGCCACCGGCATCACCCTAGACAA
AACACCTTATTCCAACATGCAGAGCAATCTTCACATTCTGGCAGAGATGTTGGCAGTCCGATGAGTAAGGGAAAC
ATGGTGGACGTAGGCCTCGACTCGTACCTCGAAGGCAATGATGATCCTCCAGAATCACTACTTGGCGAAGATGCC
CTGAGTGATGCAAGTCCACCGCCCTTCCAACGACTGAGACCGCAGTCAGAACGCACCCCCTTCATGCTAAAAGGA
AACTCTTCGCAAGGCAGGCCATCACATAGCGCACAGCTGCCGCATACAACACACAGCGAGCACACTACTCCCCAA
GAATCGGCACAGCCTAGCAATACCATTGTGGAAGGCGAGCTCTTCAGACACGACCCTTTTTTTGCCTGGATATAC
ATGATAAGCTTCGCCGCCATGATGTCGACTTTTGTTTTGGTCTGGCTCCATACAGCCCCCCGAAAGAGCCCTGTG
GGCGACACGATATATTCCACCGTTCAAAAGTCATTCGACATGCTGGCAGTCGATACGATAGTATCAGTGTTTGTC
TCTCTCATTTGGCTGGCAGCTCTTCGCTCTTTCGTCCGTCCGCTTGTCAGTGTGATACTGGTTGCCGTTCCGGTC
ATCATGCTGTCCTTTTCCTTGTACGCTTTCATCTCATCCTTCAAGGGCAGCACGCACGGATCAAGCTTCCAAGAC
AGCATTATGCGCTGGGCATCGTTTCTTCCGGCAGCGGCGTGTATCGTCTGGCTTTGGCTTGTTGTCAAGGGGCGC
AGGGCAATACAACAGGCTATTGACATTCTACAGTTCTCGAGCAAGATCCTTGCTCAGAATCCAGCCCTGCTGGTG
GTGGGATTCTGCTGCCTAGGCCTCATTATTGTGTGGACCTGGGCGTGGCTGGTCATGTTCACGCGCGTCTTTATG
GGCGGCTACTTTTCCAAGTCGCTCATTCGATTCGTGATCCAGCTTTCGAGCTGGTGGCTCGGCGCGGCTTTTGTC
CTGATGTACTTGTGGACGCTGGCCATCATCAATGCAGTGCATCGTGCAACAACGGCGGCAACAGTCTCACAGTGG
TACTTTCATCGCAATGCCGGGCCCGTCACACCGTCCAAAGATATCGTCCTGGCGGCGCTGGGACATGCTACATCG
ACGGTTTTTGGCAGTATTTGCCAGTCGACGCTCTTAGCCCTTATGATTCGTGCCCCTTTGCTGTTCTTGCCGAGG
AGACTTGGCATAGGCATCACAAATATGGCGGCGTTTTGGATGCCGACGCCAATCATGGCATTGACGAGCCCACTT
ACAGTGACTTACTCGGCCATTCACTCTCAAAATTTGGCGACGTCGGCTAGAGGCCTGGACCAGATGGAAGTGATT
TCGCCCACGATTCCCACGACAACCCTAACGCCACGGGCATTACGTTCACGTGGGCAGTACCACGGCCTGATTCCG
TATCGTCTGGCCAAACTGCTGCTCGTGGCAACTCGTTTCATCATGGCGACTGGGCTTGGCTTTGCCGGCTGGGTT
ATTACCGCCAAGCAGCTGCGGATTCAGCTGCCAGACGGCATGGGCGTGCGAGGATCTGCATATGCGTACGTTGTG
GGCCTCATGGCGAGTTTTATTGGCTACTCAGTCATGGGCGCCGTCGAGGGAATCCTGAGTGGAATCGTGGATGCC
GTGCTAGTATGCTACGGCAGCGAGAGACGCATCGAGAGGGGTCATGGGCGCTTCTGCCTCGAGGCGGCCTACCTG
TTTGGCGAGCGGCGGGTCGAATCGGATGGATACGCTTGA
Transcript >OphauB2|5137
ATGTTTTCAGAGTATGCTTCTCGTTTTCTTGCTCAGTCTCAATCGCGATTTTCGACGTTTGGCCAAGCAGACACC
GACCACGCACCGCAATCCACCGATTGGTTCTCATCACGGCCCGGCCGTCCTCATAGAGACACTGGCCGGGCCAGT
AGGTCTCTTGCTTCCCGCGGCTACACCGGCTACCAGCAGCATGGCAATGGATCCCGCTTTGGCAATATCGGTTTT
GCCTCCCGCATATCGGCCGCCCAAGATGCGCCTCTCTTCCACGGCACGCTCGATGAGTTTCGAGAAGACGACGAG
GAGGAGAGGGAACGCGAGGCAGCCGACATGTTCGCACTGCAACGGTCTCGCCGCGTAGCTGCTGCGAGCCAACTA
CTCGAAAGCACCGAGTCGGCAAACAGCCACGTCTCACTTGAGGCGAGTGCTGGCCAAATTGACAGTCCATATACT
GTACATGGACCCGGACCAAGCGTCAAGAGCAGTCGCAGCGATGCTAGAAGCAGCCACCGGCATCACCCTAGACAA
AACACCTTATTCCAACATGCAGAGCAATCTTCACATTCTGGCAGAGATGTTGGCAGTCCGATGAGTAAGGGAAAC
ATGGTGGACGTAGGCCTCGACTCGTACCTCGAAGGCAATGATGATCCTCCAGAATCACTACTTGGCGAAGATGCC
CTGAGTGATGCAAGTCCACCGCCCTTCCAACGACTGAGACCGCAGTCAGAACGCACCCCCTTCATGCTAAAAGGA
AACTCTTCGCAAGGCAGGCCATCACATAGCGCACAGCTGCCGCATACAACACACAGCGAGCACACTACTCCCCAA
GAATCGGCACAGCCTAGCAATACCATTGTGGAAGGCGAGCTCTTCAGACACGACCCTTTTTTTGCCTGGATATAC
ATGATAAGCTTCGCCGCCATGATGTCGACTTTTGTTTTGGTCTGGCTCCATACAGCCCCCCGAAAGAGCCCTGTG
GGCGACACGATATATTCCACCGTTCAAAAGTCATTCGACATGCTGGCAGTCGATACGATAGTATCAGTGTTTGTC
TCTCTCATTTGGCTGGCAGCTCTTCGCTCTTTCGTCCGTCCGCTTGTCAGTGTGATACTGGTTGCCGTTCCGGTC
ATCATGCTGTCCTTTTCCTTGTACGCTTTCATCTCATCCTTCAAGGGCAGCACGCACGGATCAAGCTTCCAAGAC
AGCATTATGCGCTGGGCATCGTTTCTTCCGGCAGCGGCGTGTATCGTCTGGCTTTGGCTTGTTGTCAAGGGGCGC
AGGGCAATACAACAGGCTATTGACATTCTACAGTTCTCGAGCAAGATCCTTGCTCAGAATCCAGCCCTGCTGGTG
GTGGGATTCTGCTGCCTAGGCCTCATTATTGTGTGGACCTGGGCGTGGCTGGTCATGTTCACGCGCGTCTTTATG
GGCGGCTACTTTTCCAAGTCGCTCATTCGATTCGTGATCCAGCTTTCGAGCTGGTGGCTCGGCGCGGCTTTTGTC
CTGATGTACTTGTGGACGCTGGCCATCATCAATGCAGTGCATCGTGCAACAACGGCGGCAACAGTCTCACAGTGG
TACTTTCATCGCAATGCCGGGCCCGTCACACCGTCCAAAGATATCGTCCTGGCGGCGCTGGGACATGCTACATCG
ACGGTTTTTGGCAGTATTTGCCAGTCGACGCTCTTAGCCCTTATGATTCGTGCCCCTTTGCTGTTCTTGCCGAGG
AGACTTGGCATAGGCATCACAAATATGGCGGCGTTTTGGATGCCGACGCCAATCATGGCATTGACGAGCCCACTT
ACAGTGACTTACTCGGCCATTCACTCTCAAAATTTGGCGACGTCGGCTAGAGGCCTGGACCAGATGGAAGTGATT
TCGCCCACGATTCCCACGACAACCCTAACGCCACGGGCATTACGTTCACGTGGGCAGTACCACGGCCTGATTCCG
TATCGTCTGGCCAAACTGCTGCTCGTGGCAACTCGTTTCATCATGGCGACTGGGCTTGGCTTTGCCGGCTGGGTT
ATTACCGCCAAGCAGCTGCGGATTCAGCTGCCAGACGGCATGGGCGTGCGAGGATCTGCATATGCGTACGTTGTG
GGCCTCATGGCGAGTTTTATTGGCTACTCAGTCATGGGCGCCGTCGAGGGAATCCTGAGTGGAATCGTGGATGCC
GTGCTAGTATGCTACGGCAGCGAGAGACGCATCGAGAGGGGTCATGGGCGCTTCTGCCTCGAGGCGGCCTACCTG
TTTGGCGAGCGGCGGGTCGAATCGGATGGATACGCTTGA
Gene >OphauB2|5137
ATGTTTTCAGAGTGTGCGACTTGACCAAGCCATTGCTCAATAGCCGTGTTTGCTAATGCCCTCTAGATGCTTCTC
GTTTTCTTGCTCAGTCTCAATCGCGATTTTCGACGTTTGGCCAAGCAGACACCGACCACGCACCGCAATCCACCG
ATTGGTTCTCATCACGGCCCGGCCGTCCTCATAGAGACACTGGCCGGGCCAGTAGGTCTCTTGCTTCCCGCGGCT
ACACCGGCTACCAGCAGCATGGCAATGGATCCCGCTTTGGCAATATCGGTTTTGCCTCCCGCATATCGGCCGCCC
AAGATGCGCCTCTCTTCCACGGCACGCTCGATGAGTTTCGAGAAGACGACGAGGAGGAGAGGGAACGCGAGGCAG
CCGACATGTTCGCACTGCAACGGTCTCGCCGCGTAGCTGCTGCGAGCCAACTACTCGAAAGCACCGAGTCGGCAA
ACAGCCACGTCTCACTTGAGGCGAGTGCTGGCCAAATTGACAGTCCATATACTGTACATGGACCCGGACCAAGCG
TCAAGAGCAGTCGCAGCGATGCTAGAAGCAGCCACCGGCATCACCCTAGACAAAACACCTTATTCCAACATGCAG
AGCAATCTTCACATTCTGGCAGAGATGTTGGCAGTCCGATGAGTAAGGGAAACATGGTGGACGTAGGCCTCGACT
CGTACCTCGAAGGCAATGATGATCCTCCAGAATCACTACTTGGCGAAGATGCCCTGAGTGATGCAAGTCCACCGC
CCTTCCAACGACTGAGACCGCAGTCAGAACGCACCCCCTTCATGCTAAAAGGAAACTCTTCGCAAGGCAGGCCAT
CACATAGCGCACAGCTGCCGCATACAACACACAGCGAGCACACTACTCCCCAAGAATCGGCACAGCCTAGCAATA
CCATTGTGGAAGGCGAGCTCTTCAGACACGACCCTTTTTTTGCCTGGATATACATGATAAGCTTCGCCGCCATGA
TGTCGACTTTTGTTTTGGTCTGGCTCCATACAGCCCCCCGAAAGAGCCCTGTGGGCGACACGATATATTCCACCG
TTCAAAAGTCATTCGACATGCTGGCAGTCGATACGATAGTATCAGTGTTTGTCTCTCTCATTTGGCTGGCAGCTC
TTCGCTCTTTCGTCCGTCCGCTTGTCAGTGTGATACTGGTTGCCGTTCCGGTCATCATGCTGTCCTTTTCCTTGT
ACGCTTTCATCTCATCCTTCAAGGGCAGCACGCACGGATCAAGCTTCCAAGACAGCATTATGCGCTGGGCATCGT
TTCTTCCGGCAGCGGCGTGTATCGTCTGGCTTTGGCTTGTTGTCAAGGGGCGCAGGGCAATACAACAGGCTATTG
ACATTCTACAGTTCTCGAGCAAGATCCTTGCTCAGAATCCAGCCCTGCTGGTGGTGGGATTCTGCTGCCTAGGCC
TCATTATTGTGTGGACCTGGGCGTGGCTGGTCATGTTCACGCGCGTCTTTATGGGCGGCTACTTTTCCAAGTCGC
TCATTCGATTCGTGATCCAGCTTTCGAGCTGGTGGCTCGGCGCGGCTTTTGTCCTGATGTACTTGTGGACGCTGG
CCATCATCAATGCAGTGCATCGTGCAACAACGGCGGCAACAGTCTCACAGTGGTACTTTCATCGCAATGCCGGGC
CCGTCACACCGTCCAAAGATATCGTCCTGGCGGCGCTGGGACATGCTACATCGACGGTTTTTGGCAGTATTTGCC
AGTCGACGCTCTTAGCCCTTATGATTCGTGCCCCTTTGCTGTTCTTGCCGAGGAGACTTGGCATAGGCATCACAA
ATATGGCGGCGTTTTGGATGCCGACGCCAATCATGGCATTGACGAGCCCACTTACAGTGACTTACTCGGCCATTC
ACTCTCAAAATTTGGCGACGTCGGCTAGAGGCCTGGACCAGATGGAAGTGATTTCGCCCACGATTCCCACGACAA
CCCTAACGCCACGGGCATTACGTTCACGTGGGCAGTACCACGGCCTGATTCCGTATCGTCTGGCCAAACTGCTGC
TCGTGGCAACTCGTTTCATCATGGCGACTGGGCTTGGCTTTGCCGGCTGGGTTATTACCGCCAAGCAGCTGCGGA
TTCAGCTGCCAGACGGCATGGGCGTGCGAGGATCTGCATATGCGTACGTTGTGGGCCTCATGGCGAGTTTTATTG
GCTACTCAGTCATGGGCGCCGTCGAGGGAATCCTGAGTGGAATCGTGGATGCCGTGCTAGTATGCTACGGCAGCG
AGAGACGCATCGAGAGGGGTCATGGGCGCTTCTGCCTCGAGGCGGCCTACCTGTTTGGCGAGCGGCGGGTCGAAT
CGGATGGATACGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail