Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5133
Gene name
LocationContig_38:118368..118735
Strand+
Gene length (bp)367
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12554 MOZART1 Mitotic-spindle organizing gamma-tubulin ring associated 4.3E-23 11 57

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4QYG1|MZT1_MAGO7 Mitotic-spindle organizing protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_14000 PE=3 SV=1 5 76 3.0E-24
sp|Q2GVR6|MZT1_CHAGB Mitotic-spindle organizing protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07938 PE=3 SV=1 1 61 3.0E-19
sp|A7EXZ2|MZT1_SCLS1 Mitotic-spindle organizing protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10207 PE=3 SV=1 2 70 4.0E-18
sp|Q1DRC2|MZT1_COCIM Mitotic-spindle organizing protein 1 OS=Coccidioides immitis (strain RS) GN=CIMG_07141 PE=3 SV=1 5 60 4.0E-18
sp|A6S6H9|MZT1_BOTFB Mitotic-spindle organizing protein 1 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_08507 PE=3 SV=1 2 70 9.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4QYG1|MZT1_MAGO7 Mitotic-spindle organizing protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_14000 PE=3 SV=1 5 76 3.0E-24
sp|Q2GVR6|MZT1_CHAGB Mitotic-spindle organizing protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07938 PE=3 SV=1 1 61 3.0E-19
sp|A7EXZ2|MZT1_SCLS1 Mitotic-spindle organizing protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10207 PE=3 SV=1 2 70 4.0E-18
sp|Q1DRC2|MZT1_COCIM Mitotic-spindle organizing protein 1 OS=Coccidioides immitis (strain RS) GN=CIMG_07141 PE=3 SV=1 5 60 4.0E-18
sp|A6S6H9|MZT1_BOTFB Mitotic-spindle organizing protein 1 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_08507 PE=3 SV=1 2 70 9.0E-18
sp|Q5BDL9|MZT1_EMENI Mitotic-spindle organizing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1361 PE=3 SV=1 5 63 3.0E-17
sp|A1CQI3|MZT1_ASPCL Mitotic-spindle organizing protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_026210 PE=3 SV=1 1 59 1.0E-15
sp|P0CF96|MZT1_SCHPO Mitotic-spindle organizing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mzt1 PE=1 SV=3 9 64 3.0E-13
sp|P0C8Y1|MZT1_DANRE Mitotic-spindle organizing protein 1 OS=Danio rerio GN=mzt1 PE=3 SV=1 2 75 3.0E-12
sp|B5FXZ4|MZT1_TAEGU Mitotic-spindle organizing protein 1 OS=Taeniopygia guttata GN=mzt1 PE=3 SV=1 9 61 4.0E-12
sp|P0CP04|MZT1_CRYNJ Mitotic-spindle organizing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA01750 PE=3 SV=1 10 64 8.0E-12
sp|P0CP05|MZT1_CRYNB Mitotic-spindle organizing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBA1680 PE=3 SV=1 10 64 8.0E-12
sp|Q0VFD6|MZT1_XENTR Mitotic-spindle organizing protein 1 OS=Xenopus tropicalis GN=mzt1 PE=3 SV=1 9 61 9.0E-12
sp|Q5U4M5|MZT1_XENLA Mitotic-spindle organizing protein 1 OS=Xenopus laevis GN=mzt1 PE=3 SV=2 9 60 2.0E-11
sp|Q8BUR9|MZT1_MOUSE Mitotic-spindle organizing protein 1 OS=Mus musculus GN=Mzt1 PE=1 SV=1 9 61 2.0E-11
sp|Q08AG7|MZT1_HUMAN Mitotic-spindle organizing protein 1 OS=Homo sapiens GN=MZT1 PE=1 SV=2 9 61 5.0E-11
sp|A9NKD9|MZT1_PICSI Mitotic-spindle organizing protein 1 OS=Picea sitchensis PE=3 SV=1 10 65 3.0E-10
sp|Q9M0N8|MZT1B_ARATH Mitotic-spindle organizing protein 1B OS=Arabidopsis thaliana GN=GIP1 PE=1 SV=1 3 60 6.0E-08
sp|Q9C9T3|MZT1A_ARATH Mitotic-spindle organizing protein 1A OS=Arabidopsis thaliana GN=GIP2 PE=1 SV=1 10 60 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000931 gamma-tubulin large complex Yes
GO:0033566 gamma-tubulin complex localization Yes
GO:0032991 protein-containing complex No
GO:0051179 localization No
GO:0031503 protein-containing complex localization No
GO:0008150 biological_process No
GO:0000930 gamma-tubulin complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5133
MPDTDKHVAAQQVVDILYEISILLNCHLDRRTLSICISMIERDVNPEALAQVIRELRQQAQLVDQLASHGNKSTQ
RECIE*
Coding >OphauB2|5133
ATGCCAGACACGGATAAACACGTCGCGGCGCAACAAGTCGTCGACATTCTTTACGAAATTAGCATTCTGCTGAAC
TGCCATCTCGACCGCCGCACGCTTTCCATCTGCATCTCCATGATTGAACGTGATGTCAATCCAGAAGCGCTTGCA
CAAGTAATAAGAGAGCTGCGACAACAAGCTCAGCTTGTCGACCAGCTCGCTTCACATGGCAATAAGAGCACTCAG
CGTGAATGTATTGAATAA
Transcript >OphauB2|5133
ATGCCAGACACGGATAAACACGTCGCGGCGCAACAAGTCGTCGACATTCTTTACGAAATTAGCATTCTGCTGAAC
TGCCATCTCGACCGCCGCACGCTTTCCATCTGCATCTCCATGATTGAACGTGATGTCAATCCAGAAGCGCTTGCA
CAAGTAATAAGAGAGCTGCGACAACAAGCTCAGCTTGTCGACCAGCTCGCTTCACATGGCAATAAGAGCACTCAG
CGTGAATGTATTGAATAA
Gene >OphauB2|5133
ATGCCAGACACGGATAAACACGTCGCGGCGCAACAAGTCGTCGACATTCTTTACGAAATTAGCATTCTGCTGGTT
CGGCGTCGTCAGCCCCAGATGCCGTCTCGCTGCTAACCGGCCCACCTCAACAGAACTGCCATCTCGACCGCCGCA
CGCTTTCCATCTGCATCTCCATGATTGAACGTGATGTCAATCCAGAAGCGCTTGCAGTTTGTTCTCCCAGAGCAA
TCCCCTTGTTTATAATAAACCTAGGCGTGCTGACGACGCCCGAATGCAGCAAGTAATAAGAGAGCTGCGACAACA
AGCTCAGCTTGTCGACCAGCTCGCTTCACATGGCAATAAGAGCACTCAGCGTGAATGTATTGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail