Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5130
Gene name
LocationContig_38:112525..113230
Strand-
Gene length (bp)705
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06201 PITH PITH domain 8.6E-42 31 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7A1|PITH1_SCHPO PITH domain-containing protein P35G2.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.02 PE=3 SV=1 28 198 3.0E-31
sp|Q9VK68|PITH1_DROME PITH domain-containing protein CG6153 OS=Drosophila melanogaster GN=CG6153 PE=2 SV=1 3 204 5.0E-27
sp|Q6DJI5|PITH1_XENLA PITH domain-containing protein 1 OS=Xenopus laevis GN=pithd1 PE=2 SV=1 1 203 2.0E-26
sp|Q9GZP4|PITH1_HUMAN PITH domain-containing protein 1 OS=Homo sapiens GN=PITHD1 PE=1 SV=1 26 203 4.0E-26
sp|Q8BWR2|PITH1_MOUSE PITH domain-containing protein 1 OS=Mus musculus GN=Pithd1 PE=1 SV=1 26 203 5.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7A1|PITH1_SCHPO PITH domain-containing protein P35G2.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.02 PE=3 SV=1 28 198 3.0E-31
sp|Q9VK68|PITH1_DROME PITH domain-containing protein CG6153 OS=Drosophila melanogaster GN=CG6153 PE=2 SV=1 3 204 5.0E-27
sp|Q6DJI5|PITH1_XENLA PITH domain-containing protein 1 OS=Xenopus laevis GN=pithd1 PE=2 SV=1 1 203 2.0E-26
sp|Q9GZP4|PITH1_HUMAN PITH domain-containing protein 1 OS=Homo sapiens GN=PITHD1 PE=1 SV=1 26 203 4.0E-26
sp|Q8BWR2|PITH1_MOUSE PITH domain-containing protein 1 OS=Mus musculus GN=Pithd1 PE=1 SV=1 26 203 5.0E-26
sp|Q6NYX8|PITH1_DANRE PITH domain-containing protein 1 OS=Danio rerio GN=pithd1 PE=2 SV=1 26 203 7.0E-26
sp|Q29L80|PITH1_DROPS PITH domain-containing protein GA19395 OS=Drosophila pseudoobscura pseudoobscura GN=GA19395 PE=3 SV=1 13 204 2.0E-25
sp|Q54Z24|PITH1_DICDI PITH domain-containing protein 1 OS=Dictyostelium discoideum GN=DDB_G0277951 PE=3 SV=1 19 203 1.0E-23
sp|Q95ZI6|PITH1_CAEEL PITH domain-containing protein ZK353.9 OS=Caenorhabditis elegans GN=ZK353.9 PE=3 SV=1 10 198 5.0E-16
sp|Q920J4|TXNL1_RAT Thioredoxin-like protein 1 OS=Rattus norvegicus GN=Txnl1 PE=1 SV=3 69 175 2.0E-14
sp|Q8CDN6|TXNL1_MOUSE Thioredoxin-like protein 1 OS=Mus musculus GN=Txnl1 PE=1 SV=3 69 175 2.0E-14
sp|O43396|TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens GN=TXNL1 PE=1 SV=3 42 175 3.0E-14
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 65 176 2.0E-12
sp|Q9SQZ9|PITH1_ARATH PITH domain-containing protein At3g04780 OS=Arabidopsis thaliana GN=At3g04780 PE=1 SV=2 25 175 2.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5130
MSHCHDEHAGHEHEHEHDHSDDITPALQSSLYEQINFDEIVTLNEAVRDSGKKVVRKSWTQRMEPEPEIESDADE
QLLMTVPFTAQVKLHSILLRSSASACAPRTLHVYVNREDLDFGAAEELRPVQVLELAQTSEVQEIGVKRALFSSV
QRMTLFFVDNFGHETTRLSYLAFKGEWTRLGRAPASIVYEAAPQPGDHVIKGVGVNQMGSGI*
Coding >OphauB2|5130
ATGTCACACTGCCACGATGAGCACGCGGGCCACGAGCACGAGCACGAGCACGACCACTCGGACGACATTACGCCG
GCGCTGCAGTCGTCGCTCTACGAGCAAATCAATTTTGATGAAATAGTGACGCTCAACGAGGCGGTGCGGGATTCG
GGAAAAAAGGTGGTGCGCAAGTCATGGACGCAAAGGATGGAGCCCGAGCCCGAGATTGAGAGCGATGCCGATGAG
CAGCTTTTGATGACGGTGCCCTTCACGGCCCAAGTCAAGCTTCACTCGATTCTACTGCGCTCTTCAGCCTCTGCA
TGCGCGCCACGCACCCTCCATGTCTACGTGAATCGCGAGGACCTTGATTTTGGCGCAGCAGAGGAGCTGCGGCCG
GTGCAGGTCTTGGAGCTGGCCCAGACGTCCGAGGTGCAGGAGATTGGCGTTAAGCGTGCGCTTTTCAGCAGCGTG
CAGCGCATGACGCTCTTTTTTGTCGACAACTTTGGCCATGAGACGACACGCTTGAGCTATTTGGCCTTTAAGGGT
GAGTGGACGCGGCTGGGGCGTGCGCCCGCGAGCATCGTGTATGAGGCGGCACCGCAGCCTGGCGATCACGTCATT
AAGGGGGTGGGCGTCAATCAGATGGGCAGTGGTATTTGA
Transcript >OphauB2|5130
ATGTCACACTGCCACGATGAGCACGCGGGCCACGAGCACGAGCACGAGCACGACCACTCGGACGACATTACGCCG
GCGCTGCAGTCGTCGCTCTACGAGCAAATCAATTTTGATGAAATAGTGACGCTCAACGAGGCGGTGCGGGATTCG
GGAAAAAAGGTGGTGCGCAAGTCATGGACGCAAAGGATGGAGCCCGAGCCCGAGATTGAGAGCGATGCCGATGAG
CAGCTTTTGATGACGGTGCCCTTCACGGCCCAAGTCAAGCTTCACTCGATTCTACTGCGCTCTTCAGCCTCTGCA
TGCGCGCCACGCACCCTCCATGTCTACGTGAATCGCGAGGACCTTGATTTTGGCGCAGCAGAGGAGCTGCGGCCG
GTGCAGGTCTTGGAGCTGGCCCAGACGTCCGAGGTGCAGGAGATTGGCGTTAAGCGTGCGCTTTTCAGCAGCGTG
CAGCGCATGACGCTCTTTTTTGTCGACAACTTTGGCCATGAGACGACACGCTTGAGCTATTTGGCCTTTAAGGGT
GAGTGGACGCGGCTGGGGCGTGCGCCCGCGAGCATCGTGTATGAGGCGGCACCGCAGCCTGGCGATCACGTCATT
AAGGGGGTGGGCGTCAATCAGATGGGCAGTGGTATTTGA
Gene >OphauB2|5130
ATGTCACACTGCCACGATGAGCACGCGGGCCACGAGCACGAGCACGAGCACGACCACTCGGACGACATTACGCCG
GCGCTGCAGTCGTCGCTCTACGAGCAAATCAATTTTGATGAAATAGTGACGCTCAACGAGGCGGTGCGGGATTCG
GGAAAAAAGGTGGTGCGCAAGTCATGGACGCAAAGGATGGAGCCCGAGCCCGAGATTGAGAGCGATGCCGATGAG
CAGCTTTTGATGACGGTGCCGTGAGTGCATCGTGACTGGGAGCAATGGTGGGAGCAATGGGCGTCGGTGGCTAAT
GGCAGCGACAGCTTCACGGCCCAAGTCAAGCTTCACTCGATTCTACTGCGCTCTTCAGCCTCTGCATGCGCGCCA
CGCACCCTCCATGTCTACGTGAATCGCGAGGACCTTGATTTTGGCGCAGCAGAGGAGCTGCGGCCGGTGCAGGTC
TTGGAGCTGGCCCAGACGTCCGAGGTGCAGGAGATTGGCGTTAAGCGTGCGCTTTTCAGCAGCGTGCAGCGCATG
ACGCTCTTTTTTGTCGACAACTTTGGCCATGAGACGACACGCTTGAGCTATTTGGCCTTTAAGGGTGAGTGGACG
CGGCTGGGGCGTGCGCCCGCGAGCATCGTGTATGAGGCGGCACCGCAGCCTGGCGATCACGTCATTAAGGGGGTG
GGCGTCAATCAGATGGGCAGTGGTATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail