Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5129
Gene name
LocationContig_38:110962..111907
Strand-
Gene length (bp)945
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00297 Ribosomal_L3 Ribosomal protein L3 5.0E-14 131 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31334|RM09_YEAST 54S ribosomal protein L9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL9 PE=1 SV=3 11 243 2.0E-58
sp|Q9P6P6|RM09_SCHPO 54S ribosomal protein L9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl9 PE=3 SV=1 20 243 2.0E-56
sp|A7IFY1|RL3_XANP2 50S ribosomal protein L3 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplC PE=3 SV=1 33 246 3.0E-56
sp|Q5LLU6|RL3_RUEPO 50S ribosomal protein L3 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplC PE=3 SV=1 33 249 4.0E-56
sp|Q8UE18|RL3_AGRFC 50S ribosomal protein L3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplC PE=3 SV=1 33 245 6.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31334|RM09_YEAST 54S ribosomal protein L9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL9 PE=1 SV=3 11 243 2.0E-58
sp|Q9P6P6|RM09_SCHPO 54S ribosomal protein L9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl9 PE=3 SV=1 20 243 2.0E-56
sp|A7IFY1|RL3_XANP2 50S ribosomal protein L3 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplC PE=3 SV=1 33 246 3.0E-56
sp|Q5LLU6|RL3_RUEPO 50S ribosomal protein L3 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplC PE=3 SV=1 33 249 4.0E-56
sp|Q8UE18|RL3_AGRFC 50S ribosomal protein L3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplC PE=3 SV=1 33 245 6.0E-56
sp|B0UHW9|RL3_METS4 50S ribosomal protein L3 OS=Methylobacterium sp. (strain 4-46) GN=rplC PE=3 SV=1 33 260 3.0E-54
sp|Q3J5S2|RL3_RHOS4 50S ribosomal protein L3 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplC PE=3 SV=1 33 246 4.0E-54
sp|B7L0R1|RL3_METC4 50S ribosomal protein L3 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplC PE=3 SV=1 33 246 1.0E-53
sp|A9W4Q1|RL3_METEP 50S ribosomal protein L3 OS=Methylobacterium extorquens (strain PA1) GN=rplC PE=3 SV=1 33 246 1.0E-53
sp|B8IS85|RL3_METNO 50S ribosomal protein L3 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplC PE=3 SV=1 33 260 2.0E-53
sp|B0T2C2|RL3_CAUSK 50S ribosomal protein L3 OS=Caulobacter sp. (strain K31) GN=rplC PE=3 SV=1 34 246 2.0E-53
sp|B1ZLK4|RL3_METPB 50S ribosomal protein L3 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplC PE=3 SV=1 33 246 3.0E-53
sp|B1LWS6|RL3_METRJ 50S ribosomal protein L3 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplC PE=3 SV=1 33 246 4.0E-53
sp|A8LM48|RL3_DINSH 50S ribosomal protein L3 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplC PE=3 SV=1 33 246 6.0E-53
sp|A8IAS6|RL3_AZOC5 50S ribosomal protein L3 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplC PE=3 SV=2 33 246 7.0E-53
sp|A7HWR1|RL3_PARL1 50S ribosomal protein L3 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplC PE=3 SV=1 33 249 4.0E-52
sp|Q2K9L6|RL3_RHIEC 50S ribosomal protein L3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rplC PE=3 SV=1 33 245 5.0E-52
sp|Q1GK37|RL3_RUEST 50S ribosomal protein L3 OS=Ruegeria sp. (strain TM1040) GN=rplC PE=3 SV=1 33 249 5.0E-52
sp|Q0ANQ0|RL3_MARMM 50S ribosomal protein L3 OS=Maricaulis maris (strain MCS10) GN=rplC PE=3 SV=1 34 242 5.0E-52
sp|Q9A8V3|RL3_CAUCR 50S ribosomal protein L3 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplC PE=3 SV=2 34 246 6.0E-52
sp|A5V602|RL3_SPHWW 50S ribosomal protein L3 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplC PE=3 SV=2 33 246 7.0E-52
sp|Q28UW2|RL3_JANSC 50S ribosomal protein L3 OS=Jannaschia sp. (strain CCS1) GN=rplC PE=3 SV=1 33 246 1.0E-51
sp|A6X0B8|RL3_OCHA4 50S ribosomal protein L3 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplC PE=3 SV=1 33 246 2.0E-51
sp|B8ELG3|RL3_METSB 50S ribosomal protein L3 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplC PE=3 SV=1 33 246 2.0E-51
sp|B9JVN7|RL3_AGRVS 50S ribosomal protein L3 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplC PE=3 SV=1 33 245 3.0E-51
sp|Q16AF4|RL3_ROSDO 50S ribosomal protein L3 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplC PE=3 SV=1 33 246 4.0E-51
sp|Q5FTY3|RL3_GLUOX 50S ribosomal protein L3 OS=Gluconobacter oxydans (strain 621H) GN=rplC PE=3 SV=1 33 243 5.0E-51
sp|B3PWS1|RL3_RHIE6 50S ribosomal protein L3 OS=Rhizobium etli (strain CIAT 652) GN=rplC PE=3 SV=1 33 245 8.0E-51
sp|B4R8L7|RL3_PHEZH 50S ribosomal protein L3 OS=Phenylobacterium zucineum (strain HLK1) GN=rplC PE=3 SV=1 33 246 2.0E-50
sp|Q8G076|RL3_BRUSU 50S ribosomal protein L3 OS=Brucella suis biovar 1 (strain 1330) GN=rplC PE=3 SV=1 33 246 2.0E-50
sp|B2IK62|RL3_BEII9 50S ribosomal protein L3 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplC PE=3 SV=1 33 246 2.0E-50
sp|Q8YHP0|RL3_BRUME 50S ribosomal protein L3 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rplC PE=3 SV=2 33 246 3.0E-50
sp|C0RJK1|RL3_BRUMB 50S ribosomal protein L3 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplC PE=3 SV=1 33 246 3.0E-50
sp|Q57CQ8|RL3_BRUAB 50S ribosomal protein L3 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplC PE=3 SV=1 33 246 3.0E-50
sp|Q2YM03|RL3_BRUA2 50S ribosomal protein L3 OS=Brucella abortus (strain 2308) GN=rplC PE=3 SV=1 33 246 3.0E-50
sp|B2S679|RL3_BRUA1 50S ribosomal protein L3 OS=Brucella abortus (strain S19) GN=rplC PE=3 SV=1 33 246 3.0E-50
sp|B0CH32|RL3_BRUSI 50S ribosomal protein L3 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplC PE=3 SV=1 33 246 3.0E-50
sp|A5VR06|RL3_BRUO2 50S ribosomal protein L3 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplC PE=3 SV=1 33 246 3.0E-50
sp|A9M5Q0|RL3_BRUC2 50S ribosomal protein L3 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplC PE=3 SV=1 33 246 3.0E-50
sp|Q11HQ2|RL3_CHESB 50S ribosomal protein L3 OS=Chelativorans sp. (strain BNC1) GN=rplC PE=3 SV=1 33 246 7.0E-50
sp|A1B027|RL3_PARDP 50S ribosomal protein L3 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplC PE=3 SV=1 33 243 9.0E-50
sp|B5ZYT5|RL3_RHILW 50S ribosomal protein L3 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplC PE=3 SV=1 33 245 1.0E-49
sp|A9IW27|RL3_BART1 50S ribosomal protein L3 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplC PE=3 SV=1 33 246 3.0E-49
sp|Q6FZC2|RL3_BARQU 50S ribosomal protein L3 OS=Bartonella quintana (strain Toulouse) GN=rplC PE=3 SV=1 33 246 5.0E-49
sp|Q6G2W5|RL3_BARHE 50S ribosomal protein L3 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplC PE=3 SV=1 33 246 5.0E-49
sp|Q0BUQ0|RL3_GRABC 50S ribosomal protein L3 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplC PE=3 SV=1 33 246 5.0E-49
sp|Q1MIE1|RL3_RHIL3 50S ribosomal protein L3 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplC PE=3 SV=1 33 245 5.0E-49
sp|Q2W2J1|RL3_MAGSA 50S ribosomal protein L3 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplC PE=3 SV=1 33 249 9.0E-49
sp|Q134S9|RL3_RHOPS 50S ribosomal protein L3 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplC PE=3 SV=1 33 246 1.0E-48
sp|Q92QH0|RL3_RHIME 50S ribosomal protein L3 OS=Rhizobium meliloti (strain 1021) GN=rplC PE=3 SV=1 33 246 2.0E-48
sp|A5ELM7|RL3_BRASB 50S ribosomal protein L3 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplC PE=3 SV=1 33 246 2.0E-48
sp|Q1RHM1|RL3_RICBR 50S ribosomal protein L3 OS=Rickettsia bellii (strain RML369-C) GN=rplC PE=3 SV=1 33 243 2.0E-48
sp|A8GVB4|RL3_RICB8 50S ribosomal protein L3 OS=Rickettsia bellii (strain OSU 85-389) GN=rplC PE=3 SV=1 33 243 2.0E-48
sp|A6U859|RL3_SINMW 50S ribosomal protein L3 OS=Sinorhizobium medicae (strain WSM419) GN=rplC PE=3 SV=1 33 246 2.0E-48
sp|A4YSJ2|RL3_BRASO 50S ribosomal protein L3 OS=Bradyrhizobium sp. (strain ORS278) GN=rplC PE=3 SV=1 33 246 3.0E-48
sp|Q2N9B1|RL3_ERYLH 50S ribosomal protein L3 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplC PE=3 SV=1 33 249 6.0E-48
sp|A1USL4|RL3_BARBK 50S ribosomal protein L3 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rplC1 PE=3 SV=1 33 246 7.0E-48
sp|Q2IXR0|RL3_RHOP2 50S ribosomal protein L3 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplC PE=3 SV=1 33 246 9.0E-48
sp|Q3SSW6|RL3_NITWN 50S ribosomal protein L3 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplC PE=3 SV=1 33 246 9.0E-48
sp|Q1GP99|RL3_SPHAL 50S ribosomal protein L3 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplC PE=3 SV=1 33 242 9.0E-48
sp|Q1QN30|RL3_NITHX 50S ribosomal protein L3 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplC PE=3 SV=1 33 246 2.0E-47
sp|Q4UMS9|RL3_RICFE 50S ribosomal protein L3 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplC PE=3 SV=1 33 243 2.0E-47
sp|A8EZL6|RL3_RICCK 50S ribosomal protein L3 OS=Rickettsia canadensis (strain McKiel) GN=rplC PE=3 SV=1 33 243 4.0E-47
sp|Q0BYB4|RL3_HYPNA 50S ribosomal protein L3 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rplC PE=3 SV=1 34 246 4.0E-47
sp|A8GPF0|RL3_RICAH 50S ribosomal protein L3 OS=Rickettsia akari (strain Hartford) GN=rplC PE=3 SV=1 33 245 6.0E-47
sp|B3QBY0|RL3_RHOPT 50S ribosomal protein L3 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplC PE=3 SV=1 33 246 9.0E-47
sp|P60456|RL3_RHOPA 50S ribosomal protein L3 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplC PE=1 SV=1 33 246 9.0E-47
sp|Q2RQW0|RL3_RHORT 50S ribosomal protein L3 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplC PE=3 SV=1 33 249 1.0E-46
sp|Q98N57|RL3_RHILO 50S ribosomal protein L3 OS=Rhizobium loti (strain MAFF303099) GN=rplC PE=3 SV=1 33 246 2.0E-46
sp|Q211E8|RL3_RHOPB 50S ribosomal protein L3 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplC PE=3 SV=1 33 246 2.0E-46
sp|A8GT69|RL3_RICRS 50S ribosomal protein L3 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplC PE=3 SV=1 33 243 3.0E-46
sp|B0BUR0|RL3_RICRO 50S ribosomal protein L3 OS=Rickettsia rickettsii (strain Iowa) GN=rplC PE=3 SV=1 33 243 3.0E-46
sp|C4K2H9|RL3_RICPU 50S ribosomal protein L3 OS=Rickettsia peacockii (strain Rustic) GN=rplC PE=3 SV=1 33 243 3.0E-46
sp|Q92GW6|RL3_RICCN 50S ribosomal protein L3 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplC PE=3 SV=1 33 243 3.0E-46
sp|B6IRQ6|RL3_RHOCS 50S ribosomal protein L3 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplC PE=3 SV=1 33 246 3.0E-46
sp|C3PPA7|RL3_RICAE 50S ribosomal protein L3 OS=Rickettsia africae (strain ESF-5) GN=rplC PE=3 SV=1 33 243 4.0E-46
sp|Q07KL8|RL3_RHOP5 50S ribosomal protein L3 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplC PE=3 SV=1 33 246 6.0E-46
sp|B6JET3|RL3_OLICO 50S ribosomal protein L3 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplC PE=3 SV=1 33 246 6.0E-46
sp|Q5NQ64|RL3_ZYMMO 50S ribosomal protein L3 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplC PE=3 SV=1 33 246 9.0E-46
sp|Q89J84|RL3_BRADU 50S ribosomal protein L3 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplC PE=3 SV=1 33 246 1.0E-45
sp|B1VET6|RL3_CORU7 50S ribosomal protein L3 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rplC PE=3 SV=1 36 242 1.0E-45
sp|A9H3R5|RL3_GLUDA 50S ribosomal protein L3 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplC PE=3 SV=1 33 243 1.0E-45
sp|A8F2E7|RL3_RICM5 50S ribosomal protein L3 OS=Rickettsia massiliae (strain Mtu5) GN=rplC PE=3 SV=1 33 243 3.0E-45
sp|P48952|RL3_RICPR 50S ribosomal protein L3 OS=Rickettsia prowazekii (strain Madrid E) GN=rplC PE=3 SV=2 33 245 7.0E-45
sp|Q9LRN8|RK3B_ARATH 50S ribosomal protein L3-2, chloroplastic OS=Arabidopsis thaliana GN=RPL3B PE=2 SV=1 34 244 1.0E-44
sp|Q68W78|RL3_RICTY 50S ribosomal protein L3 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplC PE=3 SV=1 33 243 1.0E-43
sp|Q2G8Y0|RL3_NOVAD 50S ribosomal protein L3 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplC PE=3 SV=1 33 242 2.0E-43
sp|A5FZW5|RL3_ACICJ 50S ribosomal protein L3 OS=Acidiphilium cryptum (strain JF-5) GN=rplC PE=3 SV=1 33 246 5.0E-43
sp|Q1QDI6|RL3_PSYCK 50S ribosomal protein L3 OS=Psychrobacter cryohalolentis (strain K5) GN=rplC PE=3 SV=1 33 232 7.0E-43
sp|Q4JT47|RL3_CORJK 50S ribosomal protein L3 OS=Corynebacterium jeikeium (strain K411) GN=rplC PE=3 SV=1 36 242 7.0E-43
sp|Q8NT09|RL3_CORGL 50S ribosomal protein L3 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rplC PE=3 SV=1 36 242 2.0E-42
sp|A4QBH9|RL3_CORGB 50S ribosomal protein L3 OS=Corynebacterium glutamicum (strain R) GN=rplC PE=3 SV=1 36 242 2.0E-42
sp|Q8FS80|RL3_COREF 50S ribosomal protein L3 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rplC PE=3 SV=1 36 242 2.0E-42
sp|C4LL52|RL3_CORK4 50S ribosomal protein L3 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rplC PE=3 SV=1 36 242 3.0E-42
sp|Q0VSK3|RL3_ALCBS 50S ribosomal protein L3 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplC PE=3 SV=1 33 245 3.0E-42
sp|B2HSN1|RL3_MYCMM 50S ribosomal protein L3 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rplC PE=3 SV=1 34 243 3.0E-42
sp|Q4FUF6|RL3_PSYA2 50S ribosomal protein L3 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplC PE=3 SV=1 33 232 3.0E-42
sp|P30762|RL3_MYCLE 50S ribosomal protein L3 OS=Mycobacterium leprae (strain TN) GN=rplC PE=3 SV=3 34 243 5.0E-42
sp|A5WCJ0|RL3_PSYWF 50S ribosomal protein L3 OS=Psychrobacter sp. (strain PRwf-1) GN=rplC PE=3 SV=1 33 232 8.0E-42
sp|Q73SB3|RL3_MYCPA 50S ribosomal protein L3 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rplC PE=3 SV=1 34 243 8.0E-42
sp|A0QL18|RL3_MYCA1 50S ribosomal protein L3 OS=Mycobacterium avium (strain 104) GN=rplC PE=3 SV=1 34 243 8.0E-42
sp|Q8R7V4|RL3_CALS4 50S ribosomal protein L3 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplC PE=3 SV=1 33 244 9.0E-42
sp|A0PM63|RL3_MYCUA 50S ribosomal protein L3 OS=Mycobacterium ulcerans (strain Agy99) GN=rplC PE=3 SV=1 34 243 1.0E-41
sp|A0QSD1|RL3_MYCS2 50S ribosomal protein L3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rplC PE=1 SV=1 34 243 3.0E-41
sp|A1T4N9|RL3_MYCVP 50S ribosomal protein L3 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rplC PE=3 SV=1 34 243 3.0E-41
sp|C3PKQ2|RL3_CORA7 50S ribosomal protein L3 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=rplC PE=3 SV=1 36 242 4.0E-41
sp|Q6A6M6|RL3_PROAC 50S ribosomal protein L3 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplC PE=3 SV=1 36 245 5.0E-41
sp|A4T1U2|RL3_MYCGI 50S ribosomal protein L3 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rplC PE=3 SV=1 34 243 7.0E-41
sp|P9WH87|RL3_MYCTU 50S ribosomal protein L3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rplC PE=1 SV=1 34 243 1.0E-40
sp|P9WH86|RL3_MYCTO 50S ribosomal protein L3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rplC PE=3 SV=1 34 243 1.0E-40
sp|A5U087|RL3_MYCTA 50S ribosomal protein L3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rplC PE=3 SV=1 34 243 1.0E-40
sp|C1AL35|RL3_MYCBT 50S ribosomal protein L3 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rplC PE=3 SV=1 34 243 1.0E-40
sp|A1KGI2|RL3_MYCBP 50S ribosomal protein L3 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rplC PE=3 SV=1 34 243 1.0E-40
sp|P60441|RL3_MYCBO 50S ribosomal protein L3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rplC PE=3 SV=1 34 243 1.0E-40
sp|A9WSV9|RL3_RENSM 50S ribosomal protein L3 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rplC PE=3 SV=1 36 247 2.0E-40
sp|B8GV58|RL3_THISH 50S ribosomal protein L3 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplC PE=3 SV=1 33 244 2.0E-40
sp|P60453|RL3_CORDI 50S ribosomal protein L3 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rplC PE=3 SV=1 36 242 2.0E-40
sp|A0L5X3|RL3_MAGMM 50S ribosomal protein L3 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplC PE=3 SV=1 33 243 3.0E-40
sp|Q605B2|RL3_METCA 50S ribosomal protein L3 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplC PE=3 SV=1 33 243 3.0E-40
sp|B9KZY7|RL3_THERP 50S ribosomal protein L3 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rplC PE=3 SV=1 36 245 3.0E-40
sp|Q63Q11|RL3_BURPS 50S ribosomal protein L3 OS=Burkholderia pseudomallei (strain K96243) GN=rplC PE=3 SV=1 33 245 4.0E-40
sp|A3NEH9|RL3_BURP6 50S ribosomal protein L3 OS=Burkholderia pseudomallei (strain 668) GN=rplC PE=3 SV=1 33 245 4.0E-40
sp|Q3JMR3|RL3_BURP1 50S ribosomal protein L3 OS=Burkholderia pseudomallei (strain 1710b) GN=rplC PE=3 SV=1 33 245 4.0E-40
sp|A1V8A3|RL3_BURMS 50S ribosomal protein L3 OS=Burkholderia mallei (strain SAVP1) GN=rplC PE=3 SV=1 33 245 4.0E-40
sp|Q62GK5|RL3_BURMA 50S ribosomal protein L3 OS=Burkholderia mallei (strain ATCC 23344) GN=rplC PE=3 SV=1 33 245 4.0E-40
sp|A2S7H6|RL3_BURM9 50S ribosomal protein L3 OS=Burkholderia mallei (strain NCTC 10229) GN=rplC PE=3 SV=1 33 245 4.0E-40
sp|A3MRV4|RL3_BURM7 50S ribosomal protein L3 OS=Burkholderia mallei (strain NCTC 10247) GN=rplC PE=3 SV=1 33 245 4.0E-40
sp|A3P0B3|RL3_BURP0 50S ribosomal protein L3 OS=Burkholderia pseudomallei (strain 1106a) GN=rplC PE=3 SV=1 33 245 4.0E-40
sp|Q2SU27|RL3_BURTA 50S ribosomal protein L3 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rplC PE=3 SV=1 33 245 5.0E-40
sp|Q1BDA7|RL3_MYCSS 50S ribosomal protein L3 OS=Mycobacterium sp. (strain MCS) GN=rplC PE=3 SV=1 34 243 5.0E-40
sp|A1UBN6|RL3_MYCSK 50S ribosomal protein L3 OS=Mycobacterium sp. (strain KMS) GN=rplC PE=3 SV=1 34 243 5.0E-40
sp|A3PVC1|RL3_MYCSJ 50S ribosomal protein L3 OS=Mycobacterium sp. (strain JLS) GN=rplC PE=3 SV=1 34 243 5.0E-40
sp|Q83ES4|RL3_COXBU 50S ribosomal protein L3 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplC PE=3 SV=1 33 244 5.0E-40
sp|A9NAM4|RL3_COXBR 50S ribosomal protein L3 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplC PE=3 SV=1 33 244 5.0E-40
sp|B6J263|RL3_COXB2 50S ribosomal protein L3 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplC PE=3 SV=1 33 244 5.0E-40
sp|B6J5D2|RL3_COXB1 50S ribosomal protein L3 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplC PE=3 SV=1 33 244 8.0E-40
sp|A1TYJ7|RL3_MARHV 50S ribosomal protein L3 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplC PE=3 SV=1 33 242 9.0E-40
sp|Q5Z1W3|RL3_NOCFA 50S ribosomal protein L3 OS=Nocardia farcinica (strain IFM 10152) GN=rplC PE=3 SV=1 36 242 1.0E-39
sp|Q1IX72|RL3_DEIGD 50S ribosomal protein L3 OS=Deinococcus geothermalis (strain DSM 11300) GN=rplC PE=3 SV=1 33 242 2.0E-39
sp|A4IZT4|RL3_FRATW 50S ribosomal protein L3 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplC PE=3 SV=1 33 242 2.0E-39
sp|Q0BNS7|RL3_FRATO 50S ribosomal protein L3 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplC PE=3 SV=1 33 242 2.0E-39
sp|A0Q4I3|RL3_FRATN 50S ribosomal protein L3 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplC PE=3 SV=1 33 242 2.0E-39
sp|B2SDY5|RL3_FRATM 50S ribosomal protein L3 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplC PE=3 SV=1 33 242 2.0E-39
sp|Q2A5H0|RL3_FRATH 50S ribosomal protein L3 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplC PE=3 SV=1 33 242 2.0E-39
sp|A7N9S6|RL3_FRATF 50S ribosomal protein L3 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplC PE=3 SV=1 33 242 2.0E-39
sp|Q5NHW8|RL3_FRATT 50S ribosomal protein L3 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplC PE=3 SV=1 33 242 2.0E-39
sp|Q14JC0|RL3_FRAT1 50S ribosomal protein L3 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplC PE=3 SV=1 33 242 2.0E-39
sp|B0VQR8|RL3_ACIBS 50S ribosomal protein L3 OS=Acinetobacter baumannii (strain SDF) GN=rplC PE=3 SV=1 36 242 3.0E-39
sp|A4FPM5|RL3_SACEN 50S ribosomal protein L3 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rplC PE=3 SV=1 36 242 4.0E-39
sp|B0V6W8|RL3_ACIBY 50S ribosomal protein L3 OS=Acinetobacter baumannii (strain AYE) GN=rplC PE=3 SV=1 36 232 6.0E-39
sp|A3M983|RL3_ACIBT 50S ribosomal protein L3 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplC PE=3 SV=2 36 232 6.0E-39
sp|B7IA39|RL3_ACIB5 50S ribosomal protein L3 OS=Acinetobacter baumannii (strain AB0057) GN=rplC PE=3 SV=1 36 232 6.0E-39
sp|B7GW02|RL3_ACIB3 50S ribosomal protein L3 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplC PE=3 SV=1 36 232 6.0E-39
sp|Q3SLP9|RL3_THIDA 50S ribosomal protein L3 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplC PE=3 SV=1 33 242 7.0E-39
sp|A9KD31|RL3_COXBN 50S ribosomal protein L3 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplC PE=3 SV=1 33 244 7.0E-39
sp|B2HZM2|RL3_ACIBC 50S ribosomal protein L3 OS=Acinetobacter baumannii (strain ACICU) GN=rplC PE=3 SV=1 36 232 7.0E-39
sp|Q9HWD5|RL3_PSEAE 50S ribosomal protein L3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplC PE=3 SV=1 33 242 1.0E-38
sp|Q02T80|RL3_PSEAB 50S ribosomal protein L3 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplC PE=3 SV=1 33 242 1.0E-38
sp|B7V644|RL3_PSEA8 50S ribosomal protein L3 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplC PE=3 SV=1 33 242 1.0E-38
sp|A6UZI8|RL3_PSEA7 50S ribosomal protein L3 OS=Pseudomonas aeruginosa (strain PA7) GN=rplC PE=3 SV=1 33 242 1.0E-38
sp|C1B012|RL3_RHOOB 50S ribosomal protein L3 OS=Rhodococcus opacus (strain B4) GN=rplC PE=3 SV=1 36 242 1.0E-38
sp|Q0S3H6|RL3_RHOJR 50S ribosomal protein L3 OS=Rhodococcus jostii (strain RHA1) GN=rplC PE=3 SV=1 36 242 1.0E-38
sp|Q13TH0|RL3_BURXL 50S ribosomal protein L3 OS=Burkholderia xenovorans (strain LB400) GN=rplC PE=3 SV=1 33 245 1.0E-38
sp|B2T751|RL3_BURPP 50S ribosomal protein L3 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplC PE=3 SV=1 33 245 1.0E-38
sp|Q0ABH5|RL3_ALKEH 50S ribosomal protein L3 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rplC PE=3 SV=1 33 247 1.0E-38
sp|A1R8U5|RL3_ARTAT 50S ribosomal protein L3 OS=Arthrobacter aurescens (strain TC1) GN=rplC PE=3 SV=1 36 242 1.0E-38
sp|B2JIG6|RL3_BURP8 50S ribosomal protein L3 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rplC PE=3 SV=1 33 245 1.0E-38
sp|B0U0Y9|RL3_FRAP2 50S ribosomal protein L3 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplC PE=3 SV=1 33 242 1.0E-38
sp|A9IJ01|RL3_BORPD 50S ribosomal protein L3 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplC PE=3 SV=1 28 245 2.0E-38
sp|Q6F7R2|RL3_ACIAD 50S ribosomal protein L3 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplC PE=3 SV=1 36 232 3.0E-38
sp|C0ZW25|RL3_RHOE4 50S ribosomal protein L3 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rplC PE=3 SV=1 36 242 3.0E-38
sp|Q2S912|RL3_HAHCH 50S ribosomal protein L3 OS=Hahella chejuensis (strain KCTC 2396) GN=rplC PE=3 SV=1 33 242 3.0E-38
sp|B1Y8I7|RL3_LEPCP 50S ribosomal protein L3 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rplC PE=3 SV=1 30 244 3.0E-38
sp|A6W392|RL3_MARMS 50S ribosomal protein L3 OS=Marinomonas sp. (strain MWYL1) GN=rplC PE=3 SV=1 41 242 3.0E-38
sp|C1DAR7|RL3_LARHH 50S ribosomal protein L3 OS=Laribacter hongkongensis (strain HLHK9) GN=rplC PE=3 SV=1 33 245 4.0E-38
sp|A4VHN0|RL3_PSEU5 50S ribosomal protein L3 OS=Pseudomonas stutzeri (strain A1501) GN=rplC PE=3 SV=1 33 242 4.0E-38
sp|B1JDW4|RL3_PSEPW 50S ribosomal protein L3 OS=Pseudomonas putida (strain W619) GN=rplC PE=3 SV=1 33 242 6.0E-38
sp|Q47LJ3|RL3_THEFY 50S ribosomal protein L3 OS=Thermobifida fusca (strain YX) GN=rplC PE=3 SV=1 30 242 6.0E-38
sp|P52860|RL3_THETH 50S ribosomal protein L3 OS=Thermus thermophilus GN=rplC PE=1 SV=1 36 242 6.0E-38
sp|Q5SHN8|RL3_THET8 50S ribosomal protein L3 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplC PE=1 SV=1 36 242 6.0E-38
sp|Q72I04|RL3_THET2 50S ribosomal protein L3 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplC PE=1 SV=1 36 242 6.0E-38
sp|B5ELX9|RL3_ACIF5 50S ribosomal protein L3 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplC PE=3 SV=1 36 229 7.0E-38
sp|B7J467|RL3_ACIF2 50S ribosomal protein L3 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplC PE=3 SV=1 36 229 7.0E-38
sp|A8LC56|RL3_FRASN 50S ribosomal protein L3 OS=Frankia sp. (strain EAN1pec) GN=rplC PE=3 SV=1 36 235 7.0E-38
sp|Q2L2G0|RL3_BORA1 50S ribosomal protein L3 OS=Bordetella avium (strain 197N) GN=rplC PE=3 SV=1 28 245 7.0E-38
sp|Q889X1|RL3_PSESM 50S ribosomal protein L3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplC PE=3 SV=1 33 242 8.0E-38
sp|A9BPR8|RL3_DELAS 50S ribosomal protein L3 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rplC PE=3 SV=1 36 245 8.0E-38
sp|Q7VTD3|RL3_BORPE 50S ribosomal protein L3 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplC PE=3 SV=2 28 245 9.0E-38
sp|Q7W2F6|RL3_BORPA 50S ribosomal protein L3 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplC PE=3 SV=1 28 245 9.0E-38
sp|Q7WRC5|RL3_BORBR 50S ribosomal protein L3 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplC PE=3 SV=1 28 245 9.0E-38
sp|B0C1D3|RL3_ACAM1 50S ribosomal protein L3 OS=Acaryochloris marina (strain MBIC 11017) GN=rplC PE=3 SV=1 33 240 1.0E-37
sp|A0LRM0|RL3_ACIC1 50S ribosomal protein L3 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rplC PE=3 SV=1 36 245 1.0E-37
sp|B0KCK0|RL3_THEP3 50S ribosomal protein L3 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplC PE=3 SV=1 33 244 1.0E-37
sp|A0JZ84|RL3_ARTS2 50S ribosomal protein L3 OS=Arthrobacter sp. (strain FB24) GN=rplC PE=3 SV=1 36 242 1.0E-37
sp|B4SBU7|RL3_PELPB 50S ribosomal protein L3 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rplC PE=3 SV=1 37 242 1.0E-37
sp|Q4ZMP4|RL3_PSEU2 50S ribosomal protein L3 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplC PE=3 SV=1 33 242 1.0E-37
sp|Q88QN5|RL3_PSEPK 50S ribosomal protein L3 OS=Pseudomonas putida (strain KT2440) GN=rplC PE=3 SV=2 33 242 2.0E-37
sp|B0KK67|RL3_PSEPG 50S ribosomal protein L3 OS=Pseudomonas putida (strain GB-1) GN=rplC PE=3 SV=1 33 242 2.0E-37
sp|A5VXP7|RL3_PSEP1 50S ribosomal protein L3 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplC PE=3 SV=1 33 242 2.0E-37
sp|Q1IFW6|RL3_PSEE4 50S ribosomal protein L3 OS=Pseudomonas entomophila (strain L48) GN=rplC PE=3 SV=1 33 242 2.0E-37
sp|Q7VKD2|RL3_HAEDU 50S ribosomal protein L3 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplC PE=3 SV=1 36 242 2.0E-37
sp|A4XZ90|RL3_PSEMY 50S ribosomal protein L3 OS=Pseudomonas mendocina (strain ymp) GN=rplC PE=3 SV=1 33 242 3.0E-37
sp|Q0AIJ5|RL3_NITEC 50S ribosomal protein L3 OS=Nitrosomonas eutropha (strain C91) GN=rplC PE=3 SV=1 33 254 4.0E-37
sp|Q4K533|RL3_PSEF5 50S ribosomal protein L3 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplC PE=3 SV=1 33 242 5.0E-37
sp|Q48D36|RL3_PSE14 50S ribosomal protein L3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplC PE=3 SV=1 33 242 5.0E-37
sp|Q0RRS1|RL3_FRAAA 50S ribosomal protein L3 OS=Frankia alni (strain ACN14a) GN=rplC PE=3 SV=1 36 243 5.0E-37
sp|Q4FLL8|RL3_PELUB 50S ribosomal protein L3 OS=Pelagibacter ubique (strain HTCC1062) GN=rplC PE=3 SV=1 41 230 5.0E-37
sp|Q3B6G1|RL3_CHLL7 50S ribosomal protein L3 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplC PE=3 SV=1 37 242 5.0E-37
sp|Q2JFH6|RL3_FRASC 50S ribosomal protein L3 OS=Frankia sp. (strain CcI3) GN=rplC PE=3 SV=1 36 243 6.0E-37
sp|A9KJJ4|RL3_CLOPH 50S ribosomal protein L3 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplC PE=3 SV=1 33 242 6.0E-37
sp|Q3K5Y8|RL3_PSEPF 50S ribosomal protein L3 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplC PE=3 SV=1 33 242 7.0E-37
sp|Q1LI37|RL3_CUPMC 50S ribosomal protein L3 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplC PE=3 SV=1 33 245 7.0E-37
sp|A1KRH3|RL3_NEIMF 50S ribosomal protein L3 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplC PE=3 SV=1 36 229 7.0E-37
sp|P60444|RL3_NEIMB 50S ribosomal protein L3 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplC PE=3 SV=1 36 229 7.0E-37
sp|P60443|RL3_NEIMA 50S ribosomal protein L3 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplC PE=3 SV=1 36 229 7.0E-37
sp|Q5F5S7|RL3_NEIG1 50S ribosomal protein L3 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rplC PE=3 SV=1 36 229 7.0E-37
sp|C5BQ61|RL3_TERTT 50S ribosomal protein L3 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplC PE=3 SV=1 33 247 8.0E-37
sp|Q2YAZ7|RL3_NITMU 50S ribosomal protein L3 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplC PE=3 SV=1 36 246 8.0E-37
sp|B3QR75|RL3_CHLP8 50S ribosomal protein L3 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rplC PE=3 SV=1 37 242 9.0E-37
sp|Q1H4N7|RL3_METFK 50S ribosomal protein L3 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rplC PE=3 SV=1 33 245 9.0E-37
sp|Q82X88|RL3_NITEU 50S ribosomal protein L3 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplC PE=3 SV=1 33 243 9.0E-37
sp|B1W407|RL3_STRGG 50S ribosomal protein L3 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rplC PE=3 SV=1 36 242 1.0E-36
sp|Q3J8R4|RL3_NITOC 50S ribosomal protein L3 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplC PE=3 SV=1 33 242 1.0E-36
sp|A8GYX6|RL3_SHEPA 50S ribosomal protein L3 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplC PE=3 SV=1 33 229 1.0E-36
sp|B8HD06|RL3_ARTCA 50S ribosomal protein L3 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=rplC PE=3 SV=1 36 242 1.0E-36
sp|A9M3W6|RL3_NEIM0 50S ribosomal protein L3 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplC PE=3 SV=1 36 229 1.0E-36
sp|A4SCQ9|RL3_CHLPM 50S ribosomal protein L3 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rplC PE=3 SV=1 37 242 1.0E-36
sp|Q1R0H5|RL3_CHRSD 50S ribosomal protein L3 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplC PE=3 SV=1 33 242 2.0E-36
sp|C3K2X6|RL3_PSEFS 50S ribosomal protein L3 OS=Pseudomonas fluorescens (strain SBW25) GN=rplC PE=3 SV=1 33 242 2.0E-36
sp|Q7NPH0|RL3_GLOVI 50S ribosomal protein L3 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplC PE=3 SV=1 33 241 2.0E-36
sp|B2GIL4|RL3_KOCRD 50S ribosomal protein L3 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rplC PE=3 SV=1 36 242 3.0E-36
sp|A1T0E2|RL3_PSYIN 50S ribosomal protein L3 OS=Psychromonas ingrahamii (strain 37) GN=rplC PE=3 SV=1 33 242 3.0E-36
sp|A1SNL8|RL3_NOCSJ 50S ribosomal protein L3 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rplC PE=3 SV=1 36 242 3.0E-36
sp|Q9CL32|RL3_PASMU 50S ribosomal protein L3 OS=Pasteurella multocida (strain Pm70) GN=rplC PE=3 SV=1 36 242 3.0E-36
sp|B4RZN2|RL3_ALTMD 50S ribosomal protein L3 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplC1 PE=3 SV=1 33 242 3.0E-36
sp|B0TM12|RL3_SHEHH 50S ribosomal protein L3 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplC PE=3 SV=1 33 229 4.0E-36
sp|C0QQM3|RL3_PERMH 50S ribosomal protein L3 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rplC PE=3 SV=1 36 276 4.0E-36
sp|Q39KG7|RL3_BURL3 50S ribosomal protein L3 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rplC PE=3 SV=1 33 244 4.0E-36
sp|B0K5P3|RL3_THEPX 50S ribosomal protein L3 OS=Thermoanaerobacter sp. (strain X514) GN=rplC PE=3 SV=1 33 244 5.0E-36
sp|Q82DP5|RL3_STRAW 50S ribosomal protein L3 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rplC PE=3 SV=1 36 242 5.0E-36
sp|A1TJ07|RL3_ACIAC 50S ribosomal protein L3 OS=Acidovorax citrulli (strain AAC00-1) GN=rplC PE=3 SV=1 36 245 6.0E-36
sp|A5CUB3|RL3_CLAM3 50S ribosomal protein L3 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rplC PE=3 SV=1 35 244 6.0E-36
sp|B0RB39|RL3_CLAMS 50S ribosomal protein L3 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rplC PE=3 SV=1 35 244 6.0E-36
sp|A9ADJ3|RL3_BURM1 50S ribosomal protein L3 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rplC PE=3 SV=1 33 244 6.0E-36
sp|Q65QV5|RL3_MANSM 50S ribosomal protein L3 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplC PE=3 SV=1 36 242 7.0E-36
sp|A6VLI8|RL3_ACTSZ 50S ribosomal protein L3 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplC PE=3 SV=1 36 242 7.0E-36
sp|Q8DMN1|RL3_THEEB 50S ribosomal protein L3 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplC PE=3 SV=1 33 241 8.0E-36
sp|B1LBP0|RL3_THESQ 50S ribosomal protein L3 OS=Thermotoga sp. (strain RQ2) GN=rplC PE=3 SV=1 37 241 8.0E-36
sp|A5IM83|RL3_THEP1 50S ribosomal protein L3 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplC PE=3 SV=1 37 241 8.0E-36
sp|P38515|RL3_THEMA 50S ribosomal protein L3 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplC PE=3 SV=1 37 241 8.0E-36
sp|A0T0X2|RK3_THAPS 50S ribosomal protein L3, chloroplastic OS=Thalassiosira pseudonana GN=rpl3 PE=3 SV=1 33 241 9.0E-36
sp|B8F755|RL3_HAEPS 50S ribosomal protein L3 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplC PE=3 SV=1 36 242 1.0E-35
sp|A4XBP6|RL3_SALTO 50S ribosomal protein L3 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rplC PE=3 SV=1 36 235 1.0E-35
sp|Q3YRK9|RL3_EHRCJ 50S ribosomal protein L3 OS=Ehrlichia canis (strain Jake) GN=rplC PE=3 SV=1 34 246 1.0E-35
sp|Q21M57|RL3_SACD2 50S ribosomal protein L3 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplC PE=3 SV=1 33 247 1.0E-35
sp|B2UEL9|RL3_RALPJ 50S ribosomal protein L3 OS=Ralstonia pickettii (strain 12J) GN=rplC PE=3 SV=1 33 245 1.0E-35
sp|Q9RXK2|RL3_DEIRA 50S ribosomal protein L3 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rplC PE=1 SV=1 36 238 1.0E-35
sp|Q9L0E0|RL3_STRCO 50S ribosomal protein L3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rplC PE=3 SV=1 36 242 1.0E-35
sp|B3PK37|RL3_CELJU 50S ribosomal protein L3 OS=Cellvibrio japonicus (strain Ueda107) GN=rplC PE=3 SV=1 33 242 1.0E-35
sp|A4ST06|RL3_AERS4 50S ribosomal protein L3 OS=Aeromonas salmonicida (strain A449) GN=rplC PE=3 SV=1 33 242 1.0E-35
sp|A3Q982|RL3_SHELP 50S ribosomal protein L3 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplC PE=3 SV=1 33 229 1.0E-35
sp|O24689|RL3_SYNP6 50S ribosomal protein L3 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplC PE=3 SV=1 33 240 2.0E-35
sp|Q31L07|RL3_SYNE7 50S ribosomal protein L3 OS=Synechococcus elongatus (strain PCC 7942) GN=rplC PE=3 SV=1 33 240 2.0E-35
sp|Q83FY6|RL3_TROWT 50S ribosomal protein L3 OS=Tropheryma whipplei (strain Twist) GN=rplC PE=3 SV=1 37 242 2.0E-35
sp|Q83I78|RL3_TROW8 50S ribosomal protein L3 OS=Tropheryma whipplei (strain TW08/27) GN=rplC PE=3 SV=1 37 242 2.0E-35
sp|Q110A7|RL3_TRIEI 50S ribosomal protein L3 OS=Trichodesmium erythraeum (strain IMS101) GN=rplC PE=3 SV=1 36 240 2.0E-35
sp|Q87T13|RL3_VIBPA 50S ribosomal protein L3 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplC PE=3 SV=1 36 242 2.0E-35
sp|B2FQ45|RL3_STRMK 50S ribosomal protein L3 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplC PE=3 SV=1 30 242 2.0E-35
sp|B4SKW3|RL3_STRM5 50S ribosomal protein L3 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplC PE=3 SV=1 30 242 2.0E-35
sp|A7MWI3|RL3_VIBCB 50S ribosomal protein L3 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplC PE=3 SV=1 36 242 2.0E-35
sp|Q8XV12|RL3_RALSO 50S ribosomal protein L3 OS=Ralstonia solanacearum (strain GMI1000) GN=rplC PE=3 SV=1 33 244 2.0E-35
sp|A2SLF7|RL3_METPP 50S ribosomal protein L3 OS=Methylibium petroleiphilum (strain PM1) GN=rplC PE=3 SV=2 34 245 2.0E-35
sp|Q1LTD8|RL3_BAUCH 50S ribosomal protein L3 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplC PE=3 SV=1 36 242 2.0E-35
sp|A8M529|RL3_SALAI 50S ribosomal protein L3 OS=Salinispora arenicola (strain CNS-205) GN=rplC PE=3 SV=1 36 235 2.0E-35
sp|Q12SV9|RL3_SHEDO 50S ribosomal protein L3 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplC PE=3 SV=1 33 230 2.0E-35
sp|A1W2Q7|RL3_ACISJ 50S ribosomal protein L3 OS=Acidovorax sp. (strain JS42) GN=rplC PE=3 SV=1 36 245 2.0E-35
sp|B9MB73|RL3_ACIET 50S ribosomal protein L3 OS=Acidovorax ebreus (strain TPSY) GN=rplC PE=3 SV=1 36 245 2.0E-35
sp|Q8RIF5|RL3_FUSNN 50S ribosomal protein L3 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rplC PE=3 SV=1 35 243 2.0E-35
sp|A6W5T8|RL3_KINRD 50S ribosomal protein L3 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rplC PE=3 SV=1 36 242 3.0E-35
sp|B9MKI1|RL3_CALBD 50S ribosomal protein L3 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplC PE=3 SV=1 36 244 3.0E-35
sp|Q8DE39|RL3_VIBVU 50S ribosomal protein L3 OS=Vibrio vulnificus (strain CMCP6) GN=rplC PE=3 SV=1 36 242 3.0E-35
sp|A1WVC2|RL3_HALHL 50S ribosomal protein L3 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplC PE=3 SV=1 36 242 3.0E-35
sp|B0BST1|RL3_ACTPJ 50S ribosomal protein L3 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplC PE=3 SV=1 36 242 3.0E-35
sp|B3GZ11|RL3_ACTP7 50S ribosomal protein L3 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplC PE=3 SV=1 36 242 3.0E-35
sp|A3N358|RL3_ACTP2 50S ribosomal protein L3 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplC PE=3 SV=1 36 242 3.0E-35
sp|Q7MPI8|RL3_VIBVY 50S ribosomal protein L3 OS=Vibrio vulnificus (strain YJ016) GN=rplC PE=3 SV=1 36 242 4.0E-35
sp|B6EPS5|RL3_ALISL 50S ribosomal protein L3 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplC PE=3 SV=1 36 242 4.0E-35
sp|B4E5C0|RL3_BURCJ 50S ribosomal protein L3 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rplC PE=3 SV=1 33 244 4.0E-35
sp|B1JU22|RL3_BURCC 50S ribosomal protein L3 OS=Burkholderia cenocepacia (strain MC0-3) GN=rplC PE=3 SV=1 33 244 4.0E-35
sp|Q7NQF2|RL3_CHRVO 50S ribosomal protein L3 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplC PE=3 SV=1 33 229 4.0E-35
sp|A0K3M5|RL3_BURCH 50S ribosomal protein L3 OS=Burkholderia cenocepacia (strain HI2424) GN=rplC PE=3 SV=1 33 244 4.0E-35
sp|Q1BRU8|RL3_BURCA 50S ribosomal protein L3 OS=Burkholderia cenocepacia (strain AU 1054) GN=rplC PE=3 SV=1 33 244 4.0E-35
sp|B0UX13|RL3_HISS2 50S ribosomal protein L3 OS=Histophilus somni (strain 2336) GN=rplC PE=3 SV=1 36 242 5.0E-35
sp|Q0I163|RL3_HAES1 50S ribosomal protein L3 OS=Haemophilus somnus (strain 129Pt) GN=rplC PE=3 SV=1 36 242 5.0E-35
sp|Q31IY2|RL3_THICR 50S ribosomal protein L3 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplC PE=3 SV=1 36 242 5.0E-35
sp|Q3IF25|RL3_PSEHT 50S ribosomal protein L3 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplC PE=3 SV=1 36 242 6.0E-35
sp|Q5QXZ0|RL3_IDILO 50S ribosomal protein L3 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplC PE=3 SV=1 33 242 6.0E-35
sp|Q47JA3|RL3_DECAR 50S ribosomal protein L3 OS=Dechloromonas aromatica (strain RCB) GN=rplC PE=3 SV=1 33 242 6.0E-35
sp|A8MLE0|RL3_ALKOO 50S ribosomal protein L3 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplC PE=3 SV=1 36 243 7.0E-35
sp|B7VLF7|RL3_VIBTL 50S ribosomal protein L3 OS=Vibrio tasmaniensis (strain LGP32) GN=rplC PE=3 SV=1 36 242 8.0E-35
sp|B4F1I4|RL3_PROMH 50S ribosomal protein L3 OS=Proteus mirabilis (strain HI4320) GN=rplC PE=3 SV=1 36 242 1.0E-34
sp|B8CND3|RL3_SHEPW 50S ribosomal protein L3 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplC PE=3 SV=1 33 229 1.0E-34
sp|A4JAP0|RL3_BURVG 50S ribosomal protein L3 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplC PE=3 SV=1 33 244 1.0E-34
sp|Q0BJ46|RL3_BURCM 50S ribosomal protein L3 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rplC PE=3 SV=1 33 244 1.0E-34
sp|C3LRQ8|RL3_VIBCM 50S ribosomal protein L3 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplC PE=3 SV=1 36 242 1.0E-34
sp|Q9KNY4|RL3_VIBCH 50S ribosomal protein L3 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplC PE=3 SV=1 36 242 1.0E-34
sp|A5F549|RL3_VIBC3 50S ribosomal protein L3 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplC PE=3 SV=1 36 242 1.0E-34
sp|B1YRD0|RL3_BURA4 50S ribosomal protein L3 OS=Burkholderia ambifaria (strain MC40-6) GN=rplC PE=3 SV=1 33 244 1.0E-34
sp|B0TC56|RL3_HELMI 50S ribosomal protein L3 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplC PE=3 SV=1 34 244 1.0E-34
sp|Q089Q4|RL3_SHEFN 50S ribosomal protein L3 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplC PE=3 SV=1 33 230 1.0E-34
sp|B8D0C4|RL3_HALOH 50S ribosomal protein L3 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplC PE=3 SV=1 36 245 1.0E-34
sp|A4G9T8|RL3_HERAR 50S ribosomal protein L3 OS=Herminiimonas arsenicoxydans GN=rplC PE=3 SV=1 36 245 2.0E-34
sp|P44344|RL3_HAEIN 50S ribosomal protein L3 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplC PE=3 SV=1 36 229 2.0E-34
sp|Q4QMC2|RL3_HAEI8 50S ribosomal protein L3 OS=Haemophilus influenzae (strain 86-028NP) GN=rplC PE=3 SV=1 36 229 2.0E-34
sp|C0QVZ6|RL3_BRAHW 50S ribosomal protein L3 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rplC PE=3 SV=1 35 244 2.0E-34
sp|B1KMY3|RL3_SHEWM 50S ribosomal protein L3 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplC PE=3 SV=1 33 235 2.0E-34
sp|A5UHT0|RL3_HAEIG 50S ribosomal protein L3 OS=Haemophilus influenzae (strain PittGG) GN=rplC PE=3 SV=1 36 229 2.0E-34
sp|Q2S3R4|RL3_SALRD 50S ribosomal protein L3 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplC PE=3 SV=1 33 237 2.0E-34
sp|Q7MYF1|RL3_PHOLL 50S ribosomal protein L3 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplC PE=3 SV=1 36 232 3.0E-34
sp|A8G1E8|RL3_SHESH 50S ribosomal protein L3 OS=Shewanella sediminis (strain HAW-EB3) GN=rplC PE=3 SV=1 33 235 3.0E-34
sp|Q2NQM2|RL3_SODGM 50S ribosomal protein L3 OS=Sodalis glossinidius (strain morsitans) GN=rplC PE=3 SV=1 36 232 3.0E-34
sp|A4WFC8|RL3_ENT38 50S ribosomal protein L3 OS=Enterobacter sp. (strain 638) GN=rplC PE=3 SV=1 36 242 3.0E-34
sp|Q8KAH2|RL3_CHLTE 50S ribosomal protein L3 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rplC PE=3 SV=1 37 242 3.0E-34
sp|Q6LVB6|RL3_PHOPR 50S ribosomal protein L3 OS=Photobacterium profundum GN=rplC PE=3 SV=1 36 242 4.0E-34
sp|B5FG09|RL3_VIBFM 50S ribosomal protein L3 OS=Vibrio fischeri (strain MJ11) GN=rplC PE=3 SV=1 36 242 4.0E-34
sp|Q5ZYP3|RL3_LEGPH 50S ribosomal protein L3 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplC PE=3 SV=1 33 247 4.0E-34
sp|A5IHR4|RL3_LEGPC 50S ribosomal protein L3 OS=Legionella pneumophila (strain Corby) GN=rplC PE=3 SV=1 33 247 4.0E-34
sp|Q5X859|RL3_LEGPA 50S ribosomal protein L3 OS=Legionella pneumophila (strain Paris) GN=rplC PE=3 SV=1 33 247 4.0E-34
sp|B2S0I1|RL3_BORHD 50S ribosomal protein L3 OS=Borrelia hermsii (strain HS1 / DAH) GN=rplC PE=3 SV=1 36 242 4.0E-34
sp|Q6CZX0|RL3_PECAS 50S ribosomal protein L3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplC PE=3 SV=1 36 242 5.0E-34
sp|Q6ACZ5|RL3_LEIXX 50S ribosomal protein L3 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rplC PE=3 SV=1 36 242 5.0E-34
sp|O46894|RK3_GUITH 50S ribosomal protein L3, chloroplastic OS=Guillardia theta GN=rpl3 PE=3 SV=1 33 238 6.0E-34
sp|B1XJT9|RL3_SYNP2 50S ribosomal protein L3 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplC PE=3 SV=1 33 237 6.0E-34
sp|B2VK65|RL3_ERWT9 50S ribosomal protein L3 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplC PE=3 SV=1 36 242 7.0E-34
sp|B2ITQ5|RL3_NOSP7 50S ribosomal protein L3 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rplC PE=3 SV=1 33 241 7.0E-34
sp|A9B412|RL3_HERA2 50S ribosomal protein L3 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rplC PE=3 SV=1 36 242 8.0E-34
sp|A1KB27|RL3_AZOSB 50S ribosomal protein L3 OS=Azoarcus sp. (strain BH72) GN=rplC PE=3 SV=1 33 242 8.0E-34
sp|Q3APH3|RL3_CHLCH 50S ribosomal protein L3 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplC PE=3 SV=1 37 242 8.0E-34
sp|A5D5J0|RL3_PELTS 50S ribosomal protein L3 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rplC PE=3 SV=1 36 242 9.0E-34
sp|B7IHU6|RL3_THEAB 50S ribosomal protein L3 OS=Thermosipho africanus (strain TCF52B) GN=rplC PE=3 SV=1 37 242 9.0E-34
sp|A1REB4|RL3_SHESW 50S ribosomal protein L3 OS=Shewanella sp. (strain W3-18-1) GN=rplC PE=3 SV=1 33 229 1.0E-33
sp|A4YBY3|RL3_SHEPC 50S ribosomal protein L3 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplC PE=3 SV=1 33 229 1.0E-33
sp|A1BJ34|RL3_CHLPD 50S ribosomal protein L3 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rplC PE=3 SV=1 37 242 1.0E-33
sp|A6LLL3|RL3_THEM4 50S ribosomal protein L3 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplC PE=3 SV=1 37 242 1.0E-33
sp|Q8PC49|RL3_XANCP 50S ribosomal protein L3 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplC PE=3 SV=1 30 242 1.0E-33
sp|B0RU82|RL3_XANCB 50S ribosomal protein L3 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplC PE=3 SV=1 30 242 1.0E-33
sp|Q4URD9|RL3_XANC8 50S ribosomal protein L3 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplC PE=3 SV=1 30 242 1.0E-33
sp|Q8K950|RL3_BUCAP 50S ribosomal protein L3 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplC PE=3 SV=1 36 242 1.0E-33
sp|B3R7S3|RL3_CUPTR 50S ribosomal protein L3 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplC PE=3 SV=1 33 245 1.0E-33
sp|Q0K619|RL3_CUPNH 50S ribosomal protein L3 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplC PE=3 SV=1 33 245 1.0E-33
sp|Q46WE4|RL3_CUPPJ 50S ribosomal protein L3 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplC PE=3 SV=1 36 245 1.0E-33
sp|Q3A9R6|RL3_CARHZ 50S ribosomal protein L3 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplC PE=3 SV=1 36 244 2.0E-33
sp|B1GZ83|RL3_UNCTG 50S ribosomal protein L3 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rplC PE=3 SV=1 37 231 2.0E-33
sp|B3EGZ0|RL3_CHLL2 50S ribosomal protein L3 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rplC PE=3 SV=1 37 242 2.0E-33
sp|C4L7T0|RL3_TOLAT 50S ribosomal protein L3 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplC PE=3 SV=1 36 229 2.0E-33
sp|Q5GWT3|RL3_XANOR 50S ribosomal protein L3 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplC PE=3 SV=1 30 242 2.0E-33
sp|B2SQR0|RL3_XANOP 50S ribosomal protein L3 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rplC PE=3 SV=2 30 242 2.0E-33
sp|Q2NZY5|RL3_XANOM 50S ribosomal protein L3 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplC PE=3 SV=1 30 242 2.0E-33
sp|C6DG74|RL3_PECCP 50S ribosomal protein L3 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplC PE=3 SV=1 36 242 2.0E-33
sp|Q3BWY3|RL3_XANC5 50S ribosomal protein L3 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplC PE=3 SV=1 30 242 2.0E-33
sp|Q8PNS4|RL3_XANAC 50S ribosomal protein L3 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplC PE=3 SV=1 30 242 2.0E-33
sp|Q3YWT9|RL3_SHISS 50S ribosomal protein L3 OS=Shigella sonnei (strain Ss046) GN=rplC PE=3 SV=1 36 242 2.0E-33
sp|A6T3K4|RL3_JANMA 50S ribosomal protein L3 OS=Janthinobacterium sp. (strain Marseille) GN=rplC PE=3 SV=1 36 245 2.0E-33
sp|A9KWA2|RL3_SHEB9 50S ribosomal protein L3 OS=Shewanella baltica (strain OS195) GN=rplC PE=3 SV=1 33 229 2.0E-33
sp|A6WHS8|RL3_SHEB8 50S ribosomal protein L3 OS=Shewanella baltica (strain OS185) GN=rplC PE=3 SV=1 33 229 2.0E-33
sp|A3DA72|RL3_SHEB5 50S ribosomal protein L3 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplC PE=3 SV=1 33 229 2.0E-33
sp|B8EBK5|RL3_SHEB2 50S ribosomal protein L3 OS=Shewanella baltica (strain OS223) GN=rplC PE=3 SV=1 33 229 2.0E-33
sp|A0T0H8|RK3_PHATC 50S ribosomal protein L3, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl3 PE=3 SV=1 33 237 3.0E-33
sp|B8HMQ4|RL3_CYAP4 50S ribosomal protein L3 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplC PE=3 SV=1 33 240 3.0E-33
sp|A5EX82|RL3_DICNV 50S ribosomal protein L3 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplC PE=3 SV=1 36 242 4.0E-33
sp|A0KF21|RL3_AERHH 50S ribosomal protein L3 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplC PE=3 SV=1 33 242 5.0E-33
sp|Q8ETY2|RL3_OCEIH 50S ribosomal protein L3 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplC PE=3 SV=1 33 242 6.0E-33
sp|P60447|RL3_SHIFL 50S ribosomal protein L3 OS=Shigella flexneri GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|Q0SZY3|RL3_SHIF8 50S ribosomal protein L3 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|Q32B31|RL3_SHIDS 50S ribosomal protein L3 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|Q31VV6|RL3_SHIBS 50S ribosomal protein L3 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B2U2T8|RL3_SHIB3 50S ribosomal protein L3 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B7LS40|RL3_ESCF3 50S ribosomal protein L3 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|Q1R602|RL3_ECOUT 50S ribosomal protein L3 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B1LHD4|RL3_ECOSM 50S ribosomal protein L3 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B6I234|RL3_ECOSE 50S ribosomal protein L3 OS=Escherichia coli (strain SE11) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B7NDU1|RL3_ECOLU 50S ribosomal protein L3 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|P60438|RL3_ECOLI 50S ribosomal protein L3 OS=Escherichia coli (strain K12) GN=rplC PE=1 SV=1 36 242 6.0E-33
sp|B1IPX9|RL3_ECOLC 50S ribosomal protein L3 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|P60439|RL3_ECOL6 50S ribosomal protein L3 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|Q0TCE1|RL3_ECOL5 50S ribosomal protein L3 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|A1AGK7|RL3_ECOK1 50S ribosomal protein L3 OS=Escherichia coli O1:K1 / APEC GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|A8A5C5|RL3_ECOHS 50S ribosomal protein L3 OS=Escherichia coli O9:H4 (strain HS) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B1X6H1|RL3_ECODH 50S ribosomal protein L3 OS=Escherichia coli (strain K12 / DH10B) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|C4ZUH5|RL3_ECOBW 50S ribosomal protein L3 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B7M1N4|RL3_ECO8A 50S ribosomal protein L3 OS=Escherichia coli O8 (strain IAI1) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B7N0W0|RL3_ECO81 50S ribosomal protein L3 OS=Escherichia coli O81 (strain ED1a) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B7NLN9|RL3_ECO7I 50S ribosomal protein L3 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B5YTP1|RL3_ECO5E 50S ribosomal protein L3 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|P60440|RL3_ECO57 50S ribosomal protein L3 OS=Escherichia coli O157:H7 GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B7L4K9|RL3_ECO55 50S ribosomal protein L3 OS=Escherichia coli (strain 55989 / EAEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B7MCT5|RL3_ECO45 50S ribosomal protein L3 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|B7UK44|RL3_ECO27 50S ribosomal protein L3 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|A7ZSK9|RL3_ECO24 50S ribosomal protein L3 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplC PE=3 SV=1 36 242 6.0E-33
sp|A2CC27|RL3_PROM3 50S ribosomal protein L3 OS=Prochlorococcus marinus (strain MIT 9303) GN=rplC PE=3 SV=1 33 242 6.0E-33
sp|Q46IQ9|RL3_PROMT 50S ribosomal protein L3 OS=Prochlorococcus marinus (strain NATL2A) GN=rplC PE=3 SV=1 33 246 6.0E-33
sp|C5CP53|RL3_VARPS 50S ribosomal protein L3 OS=Variovorax paradoxus (strain S110) GN=rplC PE=3 SV=1 36 244 7.0E-33
sp|A6GZ99|RL3_FLAPJ 50S ribosomal protein L3 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rplC PE=3 SV=1 35 238 7.0E-33
sp|A7MPI7|RL3_CROS8 50S ribosomal protein L3 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplC PE=3 SV=1 36 242 7.0E-33
sp|A6LEJ1|RL3_PARD8 50S ribosomal protein L3 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rplC PE=3 SV=1 36 238 7.0E-33
sp|P15766|RK3_CYAPA 50S ribosomal protein L3, cyanelle OS=Cyanophora paradoxa GN=rpl3 PE=3 SV=1 33 242 7.0E-33
sp|A1QZR4|RL3_BORT9 50S ribosomal protein L3 OS=Borrelia turicatae (strain 91E135) GN=rplC PE=3 SV=1 36 242 8.0E-33
sp|A6TEX2|RL3_KLEP7 50S ribosomal protein L3 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplC PE=3 SV=1 36 242 9.0E-33
sp|B5XN94|RL3_KLEP3 50S ribosomal protein L3 OS=Klebsiella pneumoniae (strain 342) GN=rplC PE=3 SV=1 36 242 9.0E-33
sp|B0U5A7|RL3_XYLFM 50S ribosomal protein L3 OS=Xylella fastidiosa (strain M12) GN=rplC PE=3 SV=1 36 242 9.0E-33
sp|Q8G417|RL3_BIFLO 50S ribosomal protein L3 OS=Bifidobacterium longum (strain NCC 2705) GN=rplC PE=3 SV=1 34 242 9.0E-33
sp|B3DQ13|RL3_BIFLD 50S ribosomal protein L3 OS=Bifidobacterium longum (strain DJO10A) GN=rplC PE=3 SV=1 34 242 9.0E-33
sp|A3PF47|RL3_PROM0 50S ribosomal protein L3 OS=Prochlorococcus marinus (strain MIT 9301) GN=rplC PE=3 SV=1 33 238 1.0E-32
sp|Q7V542|RL3_PROMM 50S ribosomal protein L3 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplC PE=3 SV=1 33 242 1.0E-32
sp|Q7MTL3|RL3_PORGI 50S ribosomal protein L3 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rplC PE=3 SV=1 36 238 1.0E-32
sp|B2RLZ2|RL3_PORG3 50S ribosomal protein L3 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rplC PE=3 SV=1 36 238 1.0E-32
sp|Q21RV8|RL3_RHOFT 50S ribosomal protein L3 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplC PE=3 SV=1 36 245 1.0E-32
sp|A2BTD7|RL3_PROMS 50S ribosomal protein L3 OS=Prochlorococcus marinus (strain AS9601) GN=rplC PE=3 SV=1 33 238 1.0E-32
sp|P49569|RK3_ODOSI 50S ribosomal protein L3, chloroplastic OS=Odontella sinensis GN=rpl3 PE=3 SV=2 33 237 1.0E-32
sp|Q0I0A5|RL3_SHESR 50S ribosomal protein L3 OS=Shewanella sp. (strain MR-7) GN=rplC PE=3 SV=1 33 229 1.0E-32
sp|Q0HNT7|RL3_SHESM 50S ribosomal protein L3 OS=Shewanella sp. (strain MR-4) GN=rplC PE=3 SV=1 33 229 1.0E-32
sp|A0KRM4|RL3_SHESA 50S ribosomal protein L3 OS=Shewanella sp. (strain ANA-3) GN=rplC PE=3 SV=1 33 229 1.0E-32
sp|Q8EK68|RL3_SHEON 50S ribosomal protein L3 OS=Shewanella oneidensis (strain MR-1) GN=rplC PE=3 SV=1 33 229 1.0E-32
sp|Q67JU3|RL3_SYMTH 50S ribosomal protein L3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rplC PE=3 SV=1 33 240 1.0E-32
sp|Q5WZL2|RL3_LEGPL 50S ribosomal protein L3 OS=Legionella pneumophila (strain Lens) GN=rplC PE=3 SV=1 70 247 1.0E-32
sp|B8I7X9|RL3_CLOCE 50S ribosomal protein L3 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rplC PE=3 SV=1 33 242 1.0E-32
sp|Q1XDH4|RK3_PYRYE 50S ribosomal protein L3, chloroplastic OS=Pyropia yezoensis GN=rpl3 PE=3 SV=1 33 237 1.0E-32
sp|Q15YN9|RL3_PSEA6 50S ribosomal protein L3 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplC PE=3 SV=1 33 242 2.0E-32
sp|B2UMU0|RL3_AKKM8 50S ribosomal protein L3 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rplC PE=3 SV=1 36 243 2.0E-32
sp|Q487Z3|RL3_COLP3 50S ribosomal protein L3 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplC PE=3 SV=1 33 242 2.0E-32
sp|B1JIW1|RL3_YERPY 50S ribosomal protein L3 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplC PE=3 SV=1 36 232 2.0E-32
sp|P11252|RL3_YERPS 50S ribosomal protein L3 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplC PE=3 SV=2 36 232 2.0E-32
sp|A4TGZ2|RL3_YERPP 50S ribosomal protein L3 OS=Yersinia pestis (strain Pestoides F) GN=rplC PE=3 SV=1 36 232 2.0E-32
sp|Q1CCU4|RL3_YERPN 50S ribosomal protein L3 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplC PE=3 SV=1 36 232 2.0E-32
sp|A9R8Z6|RL3_YERPG 50S ribosomal protein L3 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplC PE=3 SV=1 36 232 2.0E-32
sp|Q8ZJA9|RL3_YERPE 50S ribosomal protein L3 OS=Yersinia pestis GN=rplC PE=3 SV=1 36 232 2.0E-32
sp|B2K5N0|RL3_YERPB 50S ribosomal protein L3 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplC PE=3 SV=1 36 232 2.0E-32
sp|Q1C2U7|RL3_YERPA 50S ribosomal protein L3 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplC PE=3 SV=1 36 232 2.0E-32
sp|A7FNN5|RL3_YERP3 50S ribosomal protein L3 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplC PE=3 SV=1 36 232 2.0E-32
sp|A8G762|RL3_PROM2 50S ribosomal protein L3 OS=Prochlorococcus marinus (strain MIT 9215) GN=rplC PE=3 SV=1 33 238 2.0E-32
sp|B1XSQ1|RL3_POLNS 50S ribosomal protein L3 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplC PE=3 SV=1 33 235 2.0E-32
sp|B7GNE0|RL3_BIFLS 50S ribosomal protein L3 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rplC PE=3 SV=1 34 242 2.0E-32
sp|C4K7B8|RL3_HAMD5 50S ribosomal protein L3 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplC PE=3 SV=1 36 242 2.0E-32
sp|Q318I4|RL3_PROM9 50S ribosomal protein L3 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplC PE=3 SV=1 33 238 2.0E-32
sp|Q3MFC1|RL3_ANAVT 50S ribosomal protein L3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplC PE=3 SV=1 33 242 2.0E-32
sp|Q8A476|RL3_BACTN 50S ribosomal protein L3 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rplC PE=3 SV=1 36 238 3.0E-32
sp|B0JI03|RL3_MICAN 50S ribosomal protein L3 OS=Microcystis aeruginosa (strain NIES-843) GN=rplC PE=3 SV=1 33 242 3.0E-32
sp|A1A069|RL3_BIFAA 50S ribosomal protein L3 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rplC PE=3 SV=1 34 242 3.0E-32
sp|A5GAW5|RL3_GEOUR 50S ribosomal protein L3 OS=Geobacter uraniireducens (strain Rf4) GN=rplC PE=3 SV=1 33 244 3.0E-32
sp|B3QY24|RL3_CHLT3 50S ribosomal protein L3 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rplC PE=3 SV=1 35 241 3.0E-32
sp|P57591|RL3_BUCAI 50S ribosomal protein L3 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplC PE=3 SV=1 36 242 4.0E-32
sp|A5GIU5|RL3_SYNPW 50S ribosomal protein L3 OS=Synechococcus sp. (strain WH7803) GN=rplC PE=3 SV=1 33 242 4.0E-32
sp|A9MN46|RL3_SALAR 50S ribosomal protein L3 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplC PE=3 SV=1 36 232 4.0E-32
sp|Q9Z9L4|RL3_BACHD 50S ribosomal protein L3 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplC PE=3 SV=1 33 244 4.0E-32
sp|P75580|RL3_MYCPN 50S ribosomal protein L3 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rplC PE=3 SV=1 36 248 4.0E-32
sp|B8D849|RL3_BUCAT 50S ribosomal protein L3 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplC PE=3 SV=1 36 242 4.0E-32
sp|B8D9U7|RL3_BUCA5 50S ribosomal protein L3 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplC PE=3 SV=1 36 242 4.0E-32
sp|A5FMY1|RL3_FLAJ1 50S ribosomal protein L3 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rplC PE=3 SV=1 35 238 5.0E-32
sp|O52332|RL3_MYCGA 50S ribosomal protein L3 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rplC PE=3 SV=2 36 251 5.0E-32
sp|A1JS47|RL3_YERE8 50S ribosomal protein L3 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplC PE=3 SV=1 36 242 5.0E-32
sp|Q9FA04|RL3_BRAPL 50S ribosomal protein L3 OS=Brachyspira pilosicoli GN=rplC PE=3 SV=1 35 240 5.0E-32
sp|P60446|RL3_SALTY 50S ribosomal protein L3 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|P60445|RL3_SALTI 50S ribosomal protein L3 OS=Salmonella typhi GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|B4TXE2|RL3_SALSV 50S ribosomal protein L3 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|B5BGY6|RL3_SALPK 50S ribosomal protein L3 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|C0Q0B6|RL3_SALPC 50S ribosomal protein L3 OS=Salmonella paratyphi C (strain RKS4594) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|Q5PIV2|RL3_SALPA 50S ribosomal protein L3 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|B4SUU0|RL3_SALNS 50S ribosomal protein L3 OS=Salmonella newport (strain SL254) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|B4TKL5|RL3_SALHS 50S ribosomal protein L3 OS=Salmonella heidelberg (strain SL476) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|B5RH15|RL3_SALG2 50S ribosomal protein L3 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|B5R291|RL3_SALEP 50S ribosomal protein L3 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|B5FJL4|RL3_SALDC 50S ribosomal protein L3 OS=Salmonella dublin (strain CT_02021853) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|Q57J32|RL3_SALCH 50S ribosomal protein L3 OS=Salmonella choleraesuis (strain SC-B67) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|B5F8F2|RL3_SALA4 50S ribosomal protein L3 OS=Salmonella agona (strain SL483) GN=rplC PE=3 SV=1 36 232 6.0E-32
sp|A2C4Z9|RL3_PROM1 50S ribosomal protein L3 OS=Prochlorococcus marinus (strain NATL1A) GN=rplC PE=3 SV=1 33 242 6.0E-32
sp|Q87E82|RL3_XYLFT 50S ribosomal protein L3 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplC PE=3 SV=1 36 242 6.0E-32
sp|B2I8G9|RL3_XYLF2 50S ribosomal protein L3 OS=Xylella fastidiosa (strain M23) GN=rplC PE=3 SV=2 36 242 6.0E-32
sp|Q1ISC2|RL3_KORVE 50S ribosomal protein L3 OS=Koribacter versatilis (strain Ellin345) GN=rplC PE=3 SV=1 35 242 6.0E-32
sp|A4XLT0|RL3_CALS8 50S ribosomal protein L3 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rplC PE=3 SV=1 36 244 6.0E-32
sp|A4SUW1|RL3_POLSQ 50S ribosomal protein L3 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplC PE=3 SV=1 33 235 7.0E-32
sp|Q89A68|RL3_BUCBP 50S ribosomal protein L3 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplC PE=3 SV=1 36 244 7.0E-32
sp|Q9PE76|RL3_XYLFA 50S ribosomal protein L3 OS=Xylella fastidiosa (strain 9a5c) GN=rplC PE=3 SV=2 36 242 7.0E-32
sp|B5RPI2|RL3_BORRA 50S ribosomal protein L3 OS=Borrelia recurrentis (strain A1) GN=rplC PE=3 SV=1 36 242 8.0E-32
sp|B5RM36|RL3_BORDL 50S ribosomal protein L3 OS=Borrelia duttonii (strain Ly) GN=rplC PE=3 SV=1 36 242 8.0E-32
sp|B7K335|RL3_CYAP8 50S ribosomal protein L3 OS=Cyanothece sp. (strain PCC 8801) GN=rplC PE=3 SV=1 33 241 9.0E-32
sp|A5N4P7|RL3_CLOK5 50S ribosomal protein L3 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplC PE=3 SV=1 33 242 9.0E-32
sp|B9DYA9|RL3_CLOK1 50S ribosomal protein L3 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplC PE=3 SV=1 33 242 9.0E-32
sp|Q5P332|RL3_AROAE 50S ribosomal protein L3 OS=Aromatoleum aromaticum (strain EbN1) GN=rplC PE=3 SV=1 33 242 1.0E-31
sp|A1AVK0|RL3_RUTMC 50S ribosomal protein L3 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplC PE=3 SV=1 36 243 1.0E-31
sp|B1I1I8|RL3_DESAP 50S ribosomal protein L3 OS=Desulforudis audaxviator (strain MP104C) GN=rplC PE=3 SV=1 36 242 1.0E-31
sp|A9BCP7|RL3_PROM4 50S ribosomal protein L3 OS=Prochlorococcus marinus (strain MIT 9211) GN=rplC PE=3 SV=1 33 242 1.0E-31
sp|A1WHC5|RL3_VEREI 50S ribosomal protein L3 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rplC PE=3 SV=1 36 245 1.0E-31
sp|Q8YPH9|RL3_NOSS1 50S ribosomal protein L3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplC PE=3 SV=1 33 242 1.0E-31
sp|Q99N95|RM03_MOUSE 39S ribosomal protein L3, mitochondrial OS=Mus musculus GN=Mrpl3 PE=1 SV=1 33 240 1.0E-31
sp|B3E7T5|RL3_GEOLS 50S ribosomal protein L3 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplC PE=3 SV=1 33 242 1.0E-31
sp|A8AQM0|RL3_CITK8 50S ribosomal protein L3 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplC PE=3 SV=1 36 232 2.0E-31
sp|Q9PQR0|RL3_UREPA 50S ribosomal protein L3 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rplC PE=3 SV=1 37 242 2.0E-31
sp|B1AIM0|RL3_UREP2 50S ribosomal protein L3 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rplC PE=3 SV=1 37 242 2.0E-31
sp|Q661E3|RL3_BORBP 50S ribosomal protein L3 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rplC PE=3 SV=1 36 242 2.0E-31
sp|B4S5M7|RL3_PROA2 50S ribosomal protein L3 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rplC PE=3 SV=1 37 237 2.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5129
MQRYNRGGGDTGLPALTTGPAAALARRSATTPLRTGVLAIKKGMTSFFKGNRHIPCTVLQLDRVQVVANKTFDKH
GYWAVQIGMGTRSPSNVTHAQLGYYEVKGLAPKEALAEFMVRDESGLLPVGAQLLPDWFQKDQMVDVRARSRGMG
FAGGMKRHGFAGQPASHGNSKTHRAMGSAGPSQGSGSRVHPGKKMAGRMGNEWHTVQNLRVLKVDNDMGIVMVSG
AVPGPDGRMVKLQDAKKRKAPGLPHRNKRVQELLDRHEYGEERLEEARALHLKMKRARQGDWEKPMYTRPEPQEE
LTDSVEGAIQDARL*
Coding >OphauB2|5129
ATGCAACGCTACAACCGCGGCGGCGGAGACACCGGGCTGCCCGCCCTTACCACGGGCCCGGCCGCTGCACTGGCT
CGCCGAAGCGCAACAACGCCTCTGCGAACGGGGGTCCTGGCCATCAAGAAGGGCATGACCAGCTTCTTCAAGGGC
AACAGACACATACCCTGTACCGTGCTGCAGCTGGACCGGGTGCAAGTTGTGGCCAACAAGACGTTTGATAAGCAT
GGCTACTGGGCAGTGCAGATTGGCATGGGGACGCGGTCGCCTAGCAACGTGACGCACGCCCAGCTTGGATACTAC
GAGGTCAAGGGCCTGGCGCCCAAGGAAGCTCTCGCCGAGTTCATGGTGCGCGACGAGTCGGGCTTGCTGCCTGTT
GGCGCGCAGCTGCTGCCGGATTGGTTCCAAAAGGACCAAATGGTGGACGTGCGCGCAAGGTCGCGAGGCATGGGC
TTTGCCGGCGGCATGAAGAGACATGGCTTCGCCGGCCAGCCTGCCTCGCACGGAAACTCAAAGACGCATCGTGCC
ATGGGCTCGGCCGGTCCGTCGCAGGGCTCGGGATCGCGTGTGCATCCGGGCAAGAAGATGGCGGGCCGCATGGGC
AACGAATGGCACACGGTGCAGAACCTGCGTGTGCTCAAGGTGGATAACGACATGGGCATCGTCATGGTCAGTGGC
GCCGTCCCGGGGCCCGACGGGAGAATGGTGAAGCTGCAGGATGCAAAGAAGCGCAAAGCCCCCGGCTTGCCACAT
CGCAACAAGAGGGTCCAGGAACTGCTCGACAGACATGAATATGGAGAGGAGCGCCTCGAGGAGGCCAGGGCACTG
CATCTGAAAATGAAGAGGGCGCGGCAGGGAGACTGGGAGAAGCCCATGTACACGAGGCCTGAGCCCCAAGAAGAG
CTGACGGATTCTGTAGAGGGGGCCATTCAAGACGCCCGGCTTTAG
Transcript >OphauB2|5129
ATGCAACGCTACAACCGCGGCGGCGGAGACACCGGGCTGCCCGCCCTTACCACGGGCCCGGCCGCTGCACTGGCT
CGCCGAAGCGCAACAACGCCTCTGCGAACGGGGGTCCTGGCCATCAAGAAGGGCATGACCAGCTTCTTCAAGGGC
AACAGACACATACCCTGTACCGTGCTGCAGCTGGACCGGGTGCAAGTTGTGGCCAACAAGACGTTTGATAAGCAT
GGCTACTGGGCAGTGCAGATTGGCATGGGGACGCGGTCGCCTAGCAACGTGACGCACGCCCAGCTTGGATACTAC
GAGGTCAAGGGCCTGGCGCCCAAGGAAGCTCTCGCCGAGTTCATGGTGCGCGACGAGTCGGGCTTGCTGCCTGTT
GGCGCGCAGCTGCTGCCGGATTGGTTCCAAAAGGACCAAATGGTGGACGTGCGCGCAAGGTCGCGAGGCATGGGC
TTTGCCGGCGGCATGAAGAGACATGGCTTCGCCGGCCAGCCTGCCTCGCACGGAAACTCAAAGACGCATCGTGCC
ATGGGCTCGGCCGGTCCGTCGCAGGGCTCGGGATCGCGTGTGCATCCGGGCAAGAAGATGGCGGGCCGCATGGGC
AACGAATGGCACACGGTGCAGAACCTGCGTGTGCTCAAGGTGGATAACGACATGGGCATCGTCATGGTCAGTGGC
GCCGTCCCGGGGCCCGACGGGAGAATGGTGAAGCTGCAGGATGCAAAGAAGCGCAAAGCCCCCGGCTTGCCACAT
CGCAACAAGAGGGTCCAGGAACTGCTCGACAGACATGAATATGGAGAGGAGCGCCTCGAGGAGGCCAGGGCACTG
CATCTGAAAATGAAGAGGGCGCGGCAGGGAGACTGGGAGAAGCCCATGTACACGAGGCCTGAGCCCCAAGAAGAG
CTGACGGATTCTGTAGAGGGGGCCATTCAAGACGCCCGGCTTTAG
Gene >OphauB2|5129
ATGCAACGCTACAACCGCGGCGGCGGAGACACCGGGCTGCCCGCCCTTACCACGGGCCCGGCCGCTGCACTGGCT
CGCCGAAGCGCAACAACGCCTCTGCGAACGGGGGTCCTGGCCATCAAGAAGGGCATGACCAGCTTCTTCAAGGGC
AACAGACACATACCCTGTACCGTGCTGCAGCTGGACCGGGTGCAAGTTGTGGCCAACAAGACGTTTGATAAGCAT
GGCTACTGGGCAGTGCAGATTGGCATGGGGACGCGGTCGCCTAGCAACGTGACGCACGCCCAGCTTGGATACTAC
GAGGTCAAGGGCCTGGCGCCCAAGGAAGCTCTCGCCGAGTTCATGGTGCGCGACGAGTCGGGCTTGCTGCCTGTT
GGCGCGCAGCTGCTGCCGGATTGGTTCCAAAAGGACCAAATGGTGGACGTGCGCGCAAGGTCGCGAGGCATGGGC
TTTGCCGGCGGCATGAAGAGACATGGCTTCGCCGGCCAGCCTGCCTCGCACGGAAACTCAAAGACGCATCGTGCC
ATGGGCTCGGCCGGTCCGTCGCAGGGCTCGGGATCGCGTGTGCATCCGGGCAAGAAGATGGCGGGCCGCATGGGC
AACGAATGGCACACGGTGCAGAACCTGCGTGTGCTCAAGGTGGATAACGACATGGGCATCGTCATGGTCAGTGGC
GCCGTCCCGGGGCCCGACGGGAGAATGGTGAAGCTGCAGGATGCAAAGAAGCGCAAAGCCCCCGGCTTGCCACAT
CGCAACAAGAGGGTCCAGGAACTGCTCGACAGACATGAATATGGAGAGGAGCGCCTCGAGGAGGCCAGGGCACTG
CATCTGAAAATGAAGAGGGCGCGGCAGGGAGACTGGGAGAAGCCCATGTACACGAGGCCTGAGCCCCAAGAAGAG
CTGACGGATTCTGTAGAGGGGGCCATTCAAGACGCCCGGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail