Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5126
Gene name
LocationContig_38:105493..108962
Strand+
Gene length (bp)3469
Transcript length (bp)3036
Coding sequence length (bp)3036
Protein length (aa) 1012

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.7E-07 271 362
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.4E-08 365 427
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.3E-10 438 526
PF13637 Ank_4 Ankyrin repeats (many copies) 8.4E-08 302 354
PF13637 Ank_4 Ankyrin repeats (many copies) 2.7E-07 337 388
PF13637 Ank_4 Ankyrin repeats (many copies) 8.9E-08 469 520
PF03105 SPX SPX domain 1.2E-09 110 167
PF13606 Ank_3 Ankyrin repeat 2.3E-04 467 496
PF00023 Ank Ankyrin repeat 2.9E-04 467 498
PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family 8.7E-06 736 970

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 5 1011 0.0E+00
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 291 969 6.0E-88
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 5 196 1.0E-35
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 685 969 3.0E-24
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 305 571 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 5 1011 0.0E+00
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 291 969 6.0E-88
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 5 196 1.0E-35
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 685 969 3.0E-24
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 305 571 4.0E-22
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 298 520 7.0E-22
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 331 777 7.0E-22
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 305 520 2.0E-18
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 298 538 3.0E-18
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 305 526 3.0E-18
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 305 526 5.0E-18
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 321 518 2.0E-17
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 321 542 2.0E-17
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 282 526 2.0E-17
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 298 525 3.0E-17
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 280 525 4.0E-17
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 337 503 4.0E-17
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 280 525 8.0E-17
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 282 526 9.0E-17
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 305 525 1.0E-16
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 293 545 1.0E-16
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 321 518 1.0E-16
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 305 525 2.0E-16
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 335 547 3.0E-16
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 297 520 3.0E-16
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 335 547 4.0E-16
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 297 520 7.0E-16
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 284 526 8.0E-16
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 231 498 1.0E-15
sp|Q9C104|GDE1_SCHPO Glycerophosphodiester phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gde1 PE=1 SV=1 720 997 1.0E-15
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 287 526 2.0E-15
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 328 525 2.0E-15
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 324 496 3.0E-15
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 303 536 3.0E-15
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 325 571 3.0E-15
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 287 526 4.0E-15
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 334 538 4.0E-15
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 334 538 4.0E-15
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 308 551 4.0E-15
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 308 551 6.0E-15
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 236 520 7.0E-15
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 321 530 9.0E-15
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 321 520 9.0E-15
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 300 496 1.0E-14
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 260 491 1.0E-14
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 334 529 1.0E-14
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 267 520 1.0E-14
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 282 525 1.0E-14
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 807 997 2.0E-14
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 304 530 2.0E-14
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 321 535 2.0E-14
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 305 523 2.0E-14
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 283 496 2.0E-14
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 256 538 3.0E-14
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 263 520 3.0E-14
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 305 489 3.0E-14
sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 305 538 3.0E-14
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 283 525 3.0E-14
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 335 525 4.0E-14
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 237 525 4.0E-14
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 305 545 4.0E-14
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 305 491 4.0E-14
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 298 520 4.0E-14
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 256 538 5.0E-14
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 254 520 5.0E-14
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 324 558 5.0E-14
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 298 520 5.0E-14
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 321 520 6.0E-14
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 324 525 6.0E-14
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 337 562 6.0E-14
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 282 520 7.0E-14
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 256 520 7.0E-14
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 291 520 8.0E-14
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 304 530 8.0E-14
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 305 491 9.0E-14
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 283 525 1.0E-13
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 305 520 1.0E-13
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 328 542 1.0E-13
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 328 525 1.0E-13
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 331 520 2.0E-13
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 253 520 2.0E-13
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 298 513 2.0E-13
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 305 489 2.0E-13
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 282 520 2.0E-13
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 305 525 2.0E-13
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 305 523 2.0E-13
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 305 525 3.0E-13
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 322 571 3.0E-13
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 324 558 3.0E-13
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 338 521 4.0E-13
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 282 525 4.0E-13
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 291 520 5.0E-13
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 289 520 5.0E-13
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 289 520 5.0E-13
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 301 500 5.0E-13
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 166 538 5.0E-13
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 322 571 6.0E-13
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 291 520 8.0E-13
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 328 520 8.0E-13
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 292 520 8.0E-13
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 314 551 8.0E-13
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 301 500 1.0E-12
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 237 520 1.0E-12
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 290 520 1.0E-12
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 341 555 1.0E-12
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 298 495 1.0E-12
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 304 525 2.0E-12
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 305 520 2.0E-12
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 345 535 2.0E-12
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 335 503 2.0E-12
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 290 520 2.0E-12
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 283 496 2.0E-12
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 295 510 2.0E-12
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 282 520 2.0E-12
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 305 591 3.0E-12
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 237 516 3.0E-12
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 338 488 3.0E-12
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 290 520 3.0E-12
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 283 496 3.0E-12
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 239 520 4.0E-12
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 305 491 4.0E-12
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 292 520 4.0E-12
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 334 520 5.0E-12
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 298 495 5.0E-12
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 298 495 5.0E-12
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 298 495 5.0E-12
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 237 525 7.0E-12
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 305 574 7.0E-12
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 305 574 8.0E-12
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 237 516 8.0E-12
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 334 520 8.0E-12
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 305 525 1.0E-11
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 264 525 1.0E-11
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 291 520 1.0E-11
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 305 526 1.0E-11
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 291 520 1.0E-11
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 237 516 1.0E-11
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 283 530 1.0E-11
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 305 525 2.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 359 544 2.0E-11
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 230 591 2.0E-11
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 220 425 2.0E-11
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 334 525 2.0E-11
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 280 525 2.0E-11
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 301 520 2.0E-11
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 291 526 2.0E-11
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 291 494 2.0E-11
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 291 526 2.0E-11
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 305 525 3.0E-11
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 359 544 3.0E-11
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 230 591 3.0E-11
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 298 543 3.0E-11
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 338 520 3.0E-11
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 320 573 3.0E-11
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 312 551 3.0E-11
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 335 520 3.0E-11
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 321 526 4.0E-11
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 334 524 4.0E-11
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 338 488 4.0E-11
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 305 522 4.0E-11
sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 329 561 4.0E-11
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 230 520 5.0E-11
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 334 524 5.0E-11
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 291 494 5.0E-11
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 275 494 5.0E-11
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 278 525 6.0E-11
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 338 523 6.0E-11
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 338 523 6.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 230 520 7.0E-11
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 228 513 7.0E-11
sp|Q6EPQ3|SPXM1_ORYSJ SPX domain-containing membrane protein Os02g45520 OS=Oryza sativa subsp. japonica GN=Os02g0678200 PE=2 SV=1 5 167 7.0E-11
sp|A2X8A7|SPXM1_ORYSI SPX domain-containing membrane protein OsI_08463 OS=Oryza sativa subsp. indica GN=OsI_08463 PE=3 SV=2 5 167 7.0E-11
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 338 555 7.0E-11
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 338 522 8.0E-11
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 305 520 8.0E-11
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 338 488 8.0E-11
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 338 525 9.0E-11
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 338 488 9.0E-11
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 338 488 9.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 321 520 1.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 267 526 1.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 305 520 1.0E-10
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 383 520 1.0E-10
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 218 526 1.0E-10
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 322 571 1.0E-10
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 305 536 1.0E-10
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 280 425 1.0E-10
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 338 523 1.0E-10
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 194 525 1.0E-10
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 338 488 1.0E-10
sp|Q5PP62|SPX3_ARATH SPX domain-containing protein 3 OS=Arabidopsis thaliana GN=SPX3 PE=2 SV=1 5 192 1.0E-10
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 338 488 1.0E-10
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 247 427 1.0E-10
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 338 520 1.0E-10
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 293 497 2.0E-10
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 283 530 2.0E-10
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 340 456 2.0E-10
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 338 488 2.0E-10
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 338 488 2.0E-10
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 345 525 2.0E-10
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 338 488 2.0E-10
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 340 456 2.0E-10
sp|O48781|SPX2_ARATH SPX domain-containing protein 2 OS=Arabidopsis thaliana GN=SPX2 PE=2 SV=1 5 263 2.0E-10
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 266 550 2.0E-10
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 338 488 2.0E-10
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 259 520 3.0E-10
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 298 526 3.0E-10
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 305 491 3.0E-10
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 338 488 3.0E-10
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 338 488 3.0E-10
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 330 508 3.0E-10
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 268 498 3.0E-10
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 299 471 3.0E-10
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 338 488 3.0E-10
sp|Q8LBH4|SPX1_ARATH SPX domain-containing protein 1 OS=Arabidopsis thaliana GN=SPX1 PE=2 SV=2 5 195 3.0E-10
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 282 530 3.0E-10
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 334 520 3.0E-10
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 350 525 4.0E-10
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 298 520 4.0E-10
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 221 525 4.0E-10
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 334 520 4.0E-10
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 268 498 4.0E-10
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 305 505 4.0E-10
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 328 520 4.0E-10
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 338 488 4.0E-10
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 321 525 4.0E-10
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 225 500 4.0E-10
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 321 546 5.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 221 525 5.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 282 522 5.0E-10
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 282 522 5.0E-10
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 293 498 5.0E-10
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 345 525 5.0E-10
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 247 427 5.0E-10
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 247 427 5.0E-10
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 298 525 5.0E-10
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 247 427 5.0E-10
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 305 573 5.0E-10
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 331 538 6.0E-10
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 338 488 6.0E-10
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 338 488 6.0E-10
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 338 488 6.0E-10
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 290 521 6.0E-10
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 249 495 7.0E-10
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 340 456 7.0E-10
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 264 457 7.0E-10
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 230 523 8.0E-10
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 341 555 8.0E-10
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 334 520 8.0E-10
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 288 525 8.0E-10
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 328 520 9.0E-10
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 269 498 9.0E-10
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 334 520 9.0E-10
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 314 529 9.0E-10
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 247 427 9.0E-10
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 220 458 9.0E-10
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 228 513 1.0E-09
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 270 538 1.0E-09
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 371 520 1.0E-09
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 259 524 1.0E-09
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 305 538 1.0E-09
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 305 495 1.0E-09
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 305 573 1.0E-09
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 305 504 1.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 267 520 1.0E-09
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 288 525 1.0E-09
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 307 471 1.0E-09
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 372 520 1.0E-09
sp|Q21407|GPCP1_CAEEL Putative glycerophosphocholine phosphodiesterase GPCPD1 homolog 1 OS=Caenorhabditis elegans GN=K10B3.6 PE=3 SV=2 504 998 1.0E-09
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 310 535 1.0E-09
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 230 523 2.0E-09
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 259 525 2.0E-09
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 371 525 2.0E-09
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 364 557 2.0E-09
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 234 512 2.0E-09
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 256 537 2.0E-09
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 338 520 2.0E-09
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 278 525 2.0E-09
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 225 496 2.0E-09
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 329 525 2.0E-09
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 305 568 2.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 293 498 2.0E-09
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 334 526 2.0E-09
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 320 524 2.0E-09
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 334 526 2.0E-09
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 230 456 2.0E-09
sp|Q9HLN1|Y196_THEAC Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 268 424 2.0E-09
sp|A2X254|SPX2_ORYSI SPX domain-containing protein 2 OS=Oryza sativa subsp. indica GN=SPX2 PE=3 SV=1 5 228 2.0E-09
sp|Q6Z784|SPX2_ORYSJ SPX domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=SPX2 PE=2 SV=1 5 228 2.0E-09
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 338 534 2.0E-09
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 305 536 2.0E-09
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 371 525 3.0E-09
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 305 520 3.0E-09
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 305 568 3.0E-09
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 299 507 3.0E-09
sp|Q24145|SHARK_DROME Tyrosine-protein kinase shark OS=Drosophila melanogaster GN=shark PE=2 SV=2 285 423 3.0E-09
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 270 427 3.0E-09
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 309 520 3.0E-09
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 293 512 4.0E-09
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 305 522 4.0E-09
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 230 456 4.0E-09
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 408 525 4.0E-09
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 278 520 4.0E-09
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 305 536 4.0E-09
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 408 525 4.0E-09
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 266 550 4.0E-09
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 371 525 5.0E-09
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 282 538 5.0E-09
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 331 525 5.0E-09
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 237 525 5.0E-09
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 282 522 5.0E-09
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 237 525 5.0E-09
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 306 516 5.0E-09
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 408 525 5.0E-09
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 305 520 5.0E-09
sp|P57044|ILK_CAVPO Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 328 427 5.0E-09
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 305 505 5.0E-09
sp|Q13418|ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 328 427 5.0E-09
sp|Q99J82|ILK_RAT Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 328 427 5.0E-09
sp|O55222|ILK_MOUSE Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 328 427 5.0E-09
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 295 525 6.0E-09
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 331 525 6.0E-09
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 290 521 6.0E-09
sp|Q658H5|SPXM3_ORYSJ SPX domain-containing membrane protein Os06g0129400 OS=Oryza sativa subsp. japonica GN=Os06g0129400 PE=2 SV=1 6 167 6.0E-09
sp|A2Y8U6|SPXM3_ORYSI SPX domain-containing membrane protein OsI_21475 OS=Oryza sativa subsp. indica GN=OsI_21475 PE=3 SV=1 6 167 6.0E-09
sp|Q0JAW2|SPXM2_ORYSJ SPX domain-containing membrane protein Os04g0573000 OS=Oryza sativa subsp. japonica GN=Os04g0573000 PE=2 SV=2 5 167 6.0E-09
sp|B8AT51|SPXM2_ORYSI SPX domain-containing membrane protein OsI_17046 OS=Oryza sativa subsp. indica GN=OsI_17046 PE=3 SV=1 5 167 6.0E-09
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 278 520 6.0E-09
sp|Q3SWY2|ILK_BOVIN Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 328 427 6.0E-09
sp|Q5R5V4|ILK_PONAB Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 328 427 6.0E-09
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 295 525 7.0E-09
sp|A8DZH4|XPR1_DANRE Xenotropic and polytropic retrovirus receptor 1 homolog OS=Danio rerio GN=xpr1 PE=3 SV=1 18 190 7.0E-09
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 276 427 7.0E-09
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 285 538 7.0E-09
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 299 500 8.0E-09
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 230 456 9.0E-09
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 336 495 9.0E-09
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 230 456 9.0E-09
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 329 522 9.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 282 538 1.0E-08
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 367 522 1.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 280 520 1.0E-08
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 278 525 1.0E-08
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 213 520 1.0E-08
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 331 508 1.0E-08
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 334 494 1.0E-08
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 273 499 1.0E-08
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 341 541 1.0E-08
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 334 494 1.0E-08
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 267 499 1.0E-08
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 303 535 1.0E-08
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 335 526 1.0E-08
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 230 456 1.0E-08
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 280 471 1.0E-08
sp|Q9T050|SPXM2_ARATH SPX domain-containing membrane protein At4g11810 OS=Arabidopsis thaliana GN=At4g11810 PE=3 SV=1 6 166 1.0E-08
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 237 458 2.0E-08
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 237 455 2.0E-08
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 338 509 2.0E-08
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 371 520 2.0E-08
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 226 461 2.0E-08
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 228 526 2.0E-08
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 334 494 2.0E-08
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 225 496 2.0E-08
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 335 520 2.0E-08
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 299 551 2.0E-08
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 316 520 2.0E-08
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 339 561 2.0E-08
sp|Q7Y0F6|SPX5_ORYSJ SPX domain-containing protein 5 OS=Oryza sativa subsp. japonica GN=SPX5 PE=2 SV=1 5 184 2.0E-08
sp|A2XHU0|SPX5_ORYSI SPX domain-containing protein 5 OS=Oryza sativa subsp. indica GN=SPX5 PE=3 SV=1 5 184 2.0E-08
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 312 551 2.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 230 427 2.0E-08
sp|Q69XJ0|SPX1_ORYSJ SPX domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=SPX1 PE=2 SV=1 5 195 2.0E-08
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 280 550 2.0E-08
sp|B8B4D0|SPX1_ORYSI SPX domain-containing protein 1 OS=Oryza sativa subsp. indica GN=SPX1 PE=3 SV=1 5 195 2.0E-08
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 300 463 2.0E-08
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 304 518 2.0E-08
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 286 518 2.0E-08
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 230 456 2.0E-08
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 230 456 2.0E-08
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 328 542 2.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 228 520 3.0E-08
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 416 523 3.0E-08
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 371 520 3.0E-08
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 283 453 3.0E-08
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 281 520 3.0E-08
sp|Q93ZQ5|SPXM3_ARATH SPX domain-containing membrane protein At4g22990 OS=Arabidopsis thaliana GN=At4g22990 PE=2 SV=2 6 195 3.0E-08
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 234 429 3.0E-08
sp|Q9BQI6|SLF1_HUMAN SMC5-SMC6 complex localization factor protein 1 OS=Homo sapiens GN=SLF1 PE=1 SV=2 329 436 3.0E-08
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 280 551 3.0E-08
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 266 520 3.0E-08
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 280 480 3.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 272 531 4.0E-08
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 404 522 4.0E-08
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 283 453 4.0E-08
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 283 453 4.0E-08
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 237 525 4.0E-08
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 271 525 4.0E-08
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 292 426 4.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 305 520 5.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 328 513 5.0E-08
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 315 520 5.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 365 561 5.0E-08
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 321 425 5.0E-08
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 230 498 5.0E-08
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 226 427 5.0E-08
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 334 520 5.0E-08
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 280 471 5.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 315 520 6.0E-08
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 298 455 6.0E-08
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 352 520 6.0E-08
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 321 425 6.0E-08
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 285 518 6.0E-08
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 312 520 6.0E-08
sp|P50086|PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 329 504 6.0E-08
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 328 487 6.0E-08
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 304 518 7.0E-08
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 302 512 7.0E-08
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 334 526 7.0E-08
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 332 538 7.0E-08
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 214 520 8.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 305 525 8.0E-08
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 293 525 8.0E-08
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 225 496 8.0E-08
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 259 520 1.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 259 520 1.0E-07
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 305 520 1.0E-07
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 245 520 1.0E-07
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 404 538 1.0E-07
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 404 538 1.0E-07
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 328 541 1.0E-07
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 221 517 1.0E-07
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 242 454 1.0E-07
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 268 465 1.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 305 425 1.0E-07
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 270 538 1.0E-07
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 225 520 1.0E-07
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 321 525 1.0E-07
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 304 518 1.0E-07
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 300 526 1.0E-07
sp|Q7XEY9|SPX3_ORYSJ SPX domain-containing protein 3 OS=Oryza sativa subsp. japonica GN=SPX3 PE=2 SV=1 5 193 1.0E-07
sp|A2Z6W1|SPX3_ORYSI SPX domain-containing protein 3 OS=Oryza sativa subsp. indica GN=SPX3 PE=3 SV=1 5 193 1.0E-07
sp|A6QR20|SLF1_BOVIN SMC5-SMC6 complex localization factor protein 1 OS=Bos taurus GN=SLF1 PE=2 SV=2 329 454 1.0E-07
sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 293 483 1.0E-07
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 305 494 1.0E-07
sp|Q91955|MTPN_CHICK Myotrophin OS=Gallus gallus GN=MTPN PE=3 SV=1 328 392 1.0E-07
sp|Q28CY9|XPR1_XENTR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus tropicalis GN=xpr1 PE=2 SV=1 18 190 1.0E-07
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 341 520 1.0E-07
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 305 494 1.0E-07
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 370 520 1.0E-07
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 280 485 1.0E-07
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 341 520 1.0E-07
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 341 520 1.0E-07
sp|Q6DD44|XPR1_XENLA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus laevis GN=xpr1 PE=2 SV=1 18 190 1.0E-07
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 275 531 1.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 305 534 2.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 305 534 2.0E-07
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 272 520 2.0E-07
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 237 556 2.0E-07
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 237 520 2.0E-07
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 267 520 2.0E-07
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 300 476 2.0E-07
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 404 538 2.0E-07
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 217 536 2.0E-07
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 404 538 2.0E-07
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 404 538 2.0E-07
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 321 524 2.0E-07
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 321 454 2.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 272 465 2.0E-07
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 291 520 2.0E-07
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 325 580 2.0E-07
sp|Q9TZM3|LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans GN=lrk-1 PE=1 SV=6 222 523 2.0E-07
sp|Q9SAR5|AKR2A_ARATH Ankyrin repeat domain-containing protein 2A OS=Arabidopsis thaliana GN=AKR2A PE=1 SV=2 305 420 2.0E-07
sp|Q9Z0U0|XPR1_MOUSE Xenotropic and polytropic retrovirus receptor 1 OS=Mus musculus GN=Xpr1 PE=1 SV=1 18 184 2.0E-07
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 328 571 2.0E-07
sp|Q9QZ71|XPR1_MUSTR Xenotropic and polytropic retrovirus receptor 1 OS=Mus terricolor GN=Xpr1 PE=1 SV=1 18 184 2.0E-07
sp|A7XZ53|XPR1_MUSPA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus pahari GN=Xpr1 PE=1 SV=1 18 184 2.0E-07
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 259 547 2.0E-07
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 328 472 2.0E-07
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 305 425 2.0E-07
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 230 427 2.0E-07
sp|Q94A21|SPX4_ARATH SPX domain-containing protein 4 OS=Arabidopsis thaliana GN=SPX4 PE=2 SV=1 5 250 2.0E-07
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 337 512 2.0E-07
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 5 176 2.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 237 455 3.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 305 520 3.0E-07
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 298 455 3.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 259 524 3.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 361 520 3.0E-07
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 305 530 3.0E-07
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 321 524 3.0E-07
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 341 536 3.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 271 525 3.0E-07
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 293 525 3.0E-07
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 328 541 3.0E-07
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 298 513 3.0E-07
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 399 561 3.0E-07
sp|Q00653|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 307 546 3.0E-07
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 305 523 3.0E-07
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 306 522 3.0E-07
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 308 560 3.0E-07
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 305 498 3.0E-07
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 305 523 3.0E-07
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 308 489 3.0E-07
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 305 498 3.0E-07
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 321 425 3.0E-07
sp|Q9TU72|XPR1_NEOVI Xenotropic and polytropic retrovirus receptor 1 OS=Neovison vison GN=XPR1 PE=2 SV=1 18 184 3.0E-07
sp|Q9UBH6|XPR1_HUMAN Xenotropic and polytropic retrovirus receptor 1 OS=Homo sapiens GN=XPR1 PE=1 SV=1 18 184 3.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 259 524 4.0E-07
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 305 520 4.0E-07
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 207 520 4.0E-07
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 328 541 4.0E-07
sp|Q9R032|XPR1_MUSSP Xenotropic and polytropic retrovirus receptor 1 OS=Mus spretus GN=Xpr1 PE=1 SV=1 18 184 4.0E-07
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 379 538 4.0E-07
sp|Q5UR87|YR634_MIMIV Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 366 535 4.0E-07
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 305 498 4.0E-07
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 328 472 4.0E-07
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 305 523 4.0E-07
sp|Q2V4F9|SPXM1_ARATH SPX domain-containing membrane protein At1g63010 OS=Arabidopsis thaliana GN=At1g63010 PE=2 SV=1 6 166 4.0E-07
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 291 520 4.0E-07
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 305 523 4.0E-07
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 305 523 4.0E-07
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 338 497 4.0E-07
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 291 520 4.0E-07
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 408 525 4.0E-07
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 323 543 4.0E-07
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 323 543 4.0E-07
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 305 425 5.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 328 541 5.0E-07
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 302 532 5.0E-07
sp|Q9QZ70|XPR1_CRIGR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Cricetulus griseus GN=XPR1 PE=2 SV=1 18 184 5.0E-07
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 323 543 5.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 321 436 6.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 281 513 6.0E-07
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 282 489 6.0E-07
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 334 538 6.0E-07
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 230 498 6.0E-07
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 305 524 6.0E-07
sp|Q9R031|XPR1_MUSMC Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus musculus castaneus GN=Xpr1 PE=2 SV=1 18 184 6.0E-07
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 336 513 6.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 341 536 7.0E-07
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 234 429 7.0E-07
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 336 513 7.0E-07
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 322 489 7.0E-07
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 305 568 8.0E-07
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 282 491 8.0E-07
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 298 466 8.0E-07
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 308 532 8.0E-07
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 408 525 8.0E-07
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 328 489 8.0E-07
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 328 489 8.0E-07
sp|Q29Q26|AKR2B_ARATH Ankyrin repeat domain-containing protein 2B OS=Arabidopsis thaliana GN=AKR2B PE=1 SV=1 305 420 8.0E-07
sp|P58546|MTPN_HUMAN Myotrophin OS=Homo sapiens GN=MTPN PE=1 SV=2 328 392 8.0E-07
sp|Q863Z4|MTPN_CANLF Myotrophin OS=Canis lupus familiaris GN=MTPN PE=3 SV=3 328 392 8.0E-07
sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus GN=MTPN PE=1 SV=3 328 392 8.0E-07
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 305 530 9.0E-07
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 328 541 9.0E-07
sp|P98150|NFKB2_CHICK Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 326 525 9.0E-07
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 297 459 1.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 230 577 1.0E-06
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 335 520 1.0E-06
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 335 520 1.0E-06
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 338 509 1.0E-06
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 293 498 1.0E-06
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 291 520 1.0E-06
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 292 520 1.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 324 520 1.0E-06
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 282 453 1.0E-06
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 285 440 1.0E-06
sp|P62775|MTPN_RAT Myotrophin OS=Rattus norvegicus GN=Mtpn PE=1 SV=2 328 392 1.0E-06
sp|P62774|MTPN_MOUSE Myotrophin OS=Mus musculus GN=Mtpn PE=1 SV=2 328 392 1.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 280 544 1.0E-06
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 280 495 1.0E-06
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 305 523 1.0E-06
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 305 523 1.0E-06
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 305 499 1.0E-06
sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 328 489 1.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 230 577 2.0E-06
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 237 520 2.0E-06
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 210 427 2.0E-06
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 330 541 2.0E-06
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 293 498 2.0E-06
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 230 427 2.0E-06
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 293 440 2.0E-06
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 328 488 2.0E-06
sp|Q8R3P9|SLF1_MOUSE SMC5-SMC6 complex localization factor protein 1 OS=Mus musculus GN=Slf1 PE=1 SV=3 329 425 2.0E-06
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 305 565 2.0E-06
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 338 508 2.0E-06
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 326 455 2.0E-06
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 301 440 2.0E-06
sp|Q54KH3|ANR39_DICDI Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 357 502 2.0E-06
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 338 520 2.0E-06
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 305 565 2.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 305 501 3.0E-06
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 302 512 3.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 220 520 3.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 220 520 3.0E-06
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 321 523 3.0E-06
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 281 560 3.0E-06
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 252 469 3.0E-06
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 259 429 3.0E-06
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 288 520 3.0E-06
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 226 427 3.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 308 532 3.0E-06
sp|Q04861|NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 230 459 3.0E-06
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 338 508 3.0E-06
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 303 444 3.0E-06
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 408 525 3.0E-06
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 321 526 3.0E-06
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 331 520 4.0E-06
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 365 521 4.0E-06
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 282 491 4.0E-06
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 298 520 4.0E-06
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 405 542 4.0E-06
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 264 444 4.0E-06
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 305 494 4.0E-06
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 348 520 4.0E-06
sp|Q4R739|ANR53_MACFA Ankyrin repeat domain-containing protein 53 OS=Macaca fascicularis GN=ANKRD53 PE=2 SV=1 308 436 4.0E-06
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 268 397 5.0E-06
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 302 513 5.0E-06
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 279 500 5.0E-06
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 305 520 5.0E-06
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 325 543 5.0E-06
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 334 522 5.0E-06
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 370 520 5.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 352 525 5.0E-06
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 336 520 5.0E-06
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 317 471 5.0E-06
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 328 537 5.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 308 489 5.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 202 475 5.0E-06
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 285 449 5.0E-06
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 302 520 5.0E-06
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 298 429 5.0E-06
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 338 508 5.0E-06
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 380 538 6.0E-06
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 305 461 7.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 352 525 7.0E-06
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 321 455 7.0E-06
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 290 440 7.0E-06
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 331 425 7.0E-06
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 269 440 7.0E-06
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 305 530 8.0E-06
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 282 489 8.0E-06
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 370 526 8.0E-06
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 313 464 8.0E-06
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 275 476 9.0E-06
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 368 537 9.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 279 500 9.0E-06
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 252 469 9.0E-06
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 328 564 9.0E-06
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 305 490 1.0E-05
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 336 520 1.0E-05
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 405 538 1.0E-05
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 269 520 1.0E-05
sp|Q5NVB9|ZDH13_PONAB Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 341 500 1.0E-05
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 293 453 1.0E-05
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 370 493 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006629 lipid metabolic process Yes
GO:0008081 phosphoric diester hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1067
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3165
Ophiocordyceps australis map64 (Brazil) OphauB2|5126 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01561
Ophiocordyceps camponoti-rufipedis Ophun1|6985
Ophiocordyceps kimflemingae Ophio5|5564
Ophiocordyceps subramaniannii Hirsu2|10018

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5126
MPGGKFGKQIQKRQLEIPEYAASFVNYKALKKLIKKRSITPTLVAQNGIDASATSVDSQTALQVNKATFFFQLER
ELDKVNAFYLQKEAELKIRLKTLLDKKKVLQTRQGFSRRSSKFTTLEEGFQQFATDLSKLQQFVEINGTAFSKIL
KKWDKTSKSKTKELYLSRAVEVQPFFNAPVISELSDQATTSLQELGAWSDGIQVNFQASGHAVTSQHFIGTDEGD
TDTLLLDTVVTGNLESLRDLLAKMQTTVESSQGDSSLSDRLTRTFLAAIHEAPQEALEVLLDTGLVDLNSYDDIN
ERNCLHQAAIYGKEHVLAWGLEAGVLADRTDVYGRVPLHYASLHGRLEMLEALLNANGQTINFIDHDNFTPLIHS
IIHGNLDCIQRLLAKSARIDPVSDSDHVPLNLACEHGSEPVVELLLQHGARILSDAEGLYPQHLVARAGKSSQLL
LLLKHYGADLDQMDKLYGWTPLVHAASEGNADCLQALLKLGVDVNIVDEKDLPAMYYAAWEGHLGCMKLLARYTA
HNKTSPMAVQPPLGSTRTSDAPVPMSLDPDAIPILELPPPIIPLRRYGHNFLDTKTVIQISFDDAQHPPLVFFQD
GKYPAARLTISSKVSDLIPKNIILPIQEDTRIVSFQVDNIDTFSLDFDVFPTYGAKVIAKTVVLPSAFKSQGCSS
CCLPLFDPRLRAIGQISFSTQVIKPFQGQPLEITDFETYWKATSQLNQPTSAIVTGSSLSGDYVRLYVQHTSDGV
PVIWPRWTIVCGGLDIAVCHLSLDQFLAITAKSESRAKLVSLPSKTTDDIAQIYEIVATAGLTLTKALSILPLGV
HVNLQILYPTAEEERELALGPAMDVNVFVDAILTAVFDHARAQRAQFQSPDVARSMVFSSYNADLCTALNWKQPN
FPVFLCNDLGREKGQCGTSSKAERKSMSVKEAVRIAQSNNFMGLMCYSQLLDLVPALIDAIKSHGLALVMDKSTD
VPETNVDGNPFPRLPSGVDGVLKNHGILRFHDSIDI*
Coding >OphauB2|5126
ATGCCCGGGGGGAAGTTTGGCAAGCAGATCCAGAAGCGCCAGCTCGAGATTCCCGAATACGCCGCCAGCTTTGTC
AATTACAAGGCTCTCAAAAAGCTCATCAAGAAGCGTTCCATTACGCCCACGCTTGTCGCTCAAAATGGAATTGAC
GCCTCCGCCACATCGGTCGACTCGCAGACGGCTTTGCAAGTCAACAAGGCCACCTTCTTCTTTCAATTAGAGCGC
GAACTTGACAAGGTCAACGCCTTCTACCTGCAAAAGGAAGCCGAGCTCAAGATACGTCTCAAGACGCTGTTGGAC
AAGAAAAAGGTGCTACAGACTCGCCAGGGCTTTTCGCGCCGCTCCTCCAAGTTCACCACGCTAGAAGAGGGCTTC
CAGCAGTTTGCAACAGATCTGAGCAAGCTGCAGCAGTTTGTCGAGATCAATGGAACGGCTTTTTCTAAAATACTC
AAAAAGTGGGACAAGACGTCAAAGTCCAAGACAAAGGAGCTTTACTTGTCGCGGGCTGTCGAGGTGCAGCCCTTT
TTCAATGCTCCCGTCATAAGTGAGCTTTCCGACCAAGCCACAACAAGCTTGCAAGAGCTGGGCGCCTGGTCAGAT
GGCATTCAAGTCAATTTCCAGGCATCGGGCCACGCTGTCACAAGCCAGCATTTTATTGGAACAGACGAGGGAGAC
ACCGACACACTGCTACTTGATACGGTAGTCACGGGCAACCTCGAGTCGTTGCGCGATCTCCTCGCCAAGATGCAG
ACGACTGTTGAGTCGAGTCAAGGCGATAGTTCCTTGTCGGACCGCTTGACCCGCACCTTTTTGGCCGCCATTCAT
GAGGCGCCCCAAGAGGCCCTAGAGGTGCTGCTTGACACGGGCCTTGTTGACCTCAACTCGTACGACGACATCAAC
GAGAGGAATTGCCTACACCAGGCAGCAATCTATGGCAAGGAGCATGTCCTGGCCTGGGGCCTTGAAGCTGGCGTC
TTGGCCGACAGAACAGACGTCTATGGGCGAGTTCCGCTGCACTATGCCAGCTTGCATGGACGACTGGAAATGCTC
GAGGCCTTGCTCAATGCAAACGGACAAACAATCAATTTCATTGACCACGACAATTTTACTCCTCTGATACACTCC
ATCATTCACGGCAACCTTGACTGCATTCAACGCCTGCTGGCCAAGTCAGCACGCATTGACCCCGTGTCAGATTCA
GATCACGTCCCCTTGAACCTGGCTTGTGAGCACGGCTCGGAACCAGTGGTGGAGTTGTTGCTGCAGCACGGAGCA
CGAATTCTGTCAGATGCTGAGGGCTTGTATCCCCAGCATCTGGTGGCACGGGCGGGAAAGTCGTCTCAGTTGCTT
TTGCTGCTAAAGCACTATGGTGCAGACTTGGATCAGATGGACAAGCTCTACGGCTGGACTCCGCTAGTGCATGCC
GCCAGCGAGGGCAACGCTGACTGTCTGCAAGCCTTGCTCAAGCTTGGTGTCGATGTCAACATTGTTGATGAAAAA
GATCTGCCGGCAATGTACTATGCGGCTTGGGAGGGGCATTTGGGCTGCATGAAGCTGCTCGCACGTTACACGGCG
CACAACAAAACGAGCCCCATGGCTGTACAGCCACCGCTGGGATCCACGAGGACAAGCGATGCGCCAGTTCCCATG
TCACTCGACCCCGACGCCATTCCCATCCTCGAGCTACCGCCACCAATCATCCCCCTGCGCAGATATGGCCACAAC
TTTCTCGACACCAAGACTGTCATACAAATAAGCTTTGACGATGCACAGCATCCGCCCTTGGTGTTTTTCCAAGAT
GGCAAGTATCCCGCGGCGCGCCTCACAATCTCTTCCAAGGTGTCGGATCTCATACCCAAGAATATCATACTTCCC
ATTCAGGAAGACACGCGCATTGTGTCGTTTCAAGTGGATAATATAGACACCTTTTCCCTCGATTTTGACGTCTTC
CCGACGTATGGCGCCAAGGTTATTGCCAAGACGGTTGTATTGCCAAGTGCCTTTAAATCTCAAGGATGCTCAAGC
TGCTGTCTGCCCCTGTTCGATCCTCGCTTGCGGGCAATAGGGCAGATCAGTTTCAGCACCCAGGTCATCAAGCCC
TTTCAGGGTCAACCACTTGAGATTACAGATTTTGAAACGTACTGGAAAGCTACGAGCCAGTTGAACCAACCGACT
AGCGCCATTGTGACGGGGTCAAGCCTTTCTGGTGACTACGTGAGGCTCTACGTACAGCACACGAGCGATGGTGTG
CCCGTCATATGGCCTCGATGGACCATTGTCTGCGGAGGGCTCGACATTGCAGTCTGCCACTTGTCACTAGACCAG
TTCCTGGCCATTACAGCCAAGAGTGAGAGTCGGGCCAAGCTGGTCAGTCTGCCCTCCAAGACGACGGACGATATT
GCGCAGATATACGAAATTGTGGCCACGGCGGGATTGACGCTGACCAAGGCTTTGTCGATATTGCCGTTGGGGGTA
CACGTCAATCTTCAAATTCTTTATCCGACGGCCGAGGAAGAGCGCGAGCTTGCTTTGGGACCAGCCATGGACGTC
AATGTTTTTGTTGATGCCATCCTCACAGCCGTCTTTGACCACGCGCGTGCGCAAAGAGCACAGTTCCAGTCGCCA
GATGTGGCTCGTTCCATGGTGTTTAGCAGTTACAATGCCGACCTGTGCACAGCTCTTAACTGGAAGCAACCCAAT
TTTCCCGTCTTTCTCTGCAACGACTTGGGCAGAGAAAAGGGGCAATGCGGGACAAGCAGCAAGGCGGAGAGAAAA
AGTATGTCGGTAAAAGAGGCGGTGCGGATAGCACAGAGCAACAATTTCATGGGCCTCATGTGCTACTCGCAACTA
TTGGACTTGGTTCCTGCCTTGATCGACGCTATCAAGTCACATGGCTTGGCTCTTGTAATGGATAAGTCGACGGAC
GTTCCTGAGACGAATGTAGATGGCAACCCGTTTCCTCGACTGCCTAGTGGCGTGGATGGTGTGCTGAAAAATCAT
GGCATTTTAAGGTTTCACGATTCTATAGACATTTAG
Transcript >OphauB2|5126
ATGCCCGGGGGGAAGTTTGGCAAGCAGATCCAGAAGCGCCAGCTCGAGATTCCCGAATACGCCGCCAGCTTTGTC
AATTACAAGGCTCTCAAAAAGCTCATCAAGAAGCGTTCCATTACGCCCACGCTTGTCGCTCAAAATGGAATTGAC
GCCTCCGCCACATCGGTCGACTCGCAGACGGCTTTGCAAGTCAACAAGGCCACCTTCTTCTTTCAATTAGAGCGC
GAACTTGACAAGGTCAACGCCTTCTACCTGCAAAAGGAAGCCGAGCTCAAGATACGTCTCAAGACGCTGTTGGAC
AAGAAAAAGGTGCTACAGACTCGCCAGGGCTTTTCGCGCCGCTCCTCCAAGTTCACCACGCTAGAAGAGGGCTTC
CAGCAGTTTGCAACAGATCTGAGCAAGCTGCAGCAGTTTGTCGAGATCAATGGAACGGCTTTTTCTAAAATACTC
AAAAAGTGGGACAAGACGTCAAAGTCCAAGACAAAGGAGCTTTACTTGTCGCGGGCTGTCGAGGTGCAGCCCTTT
TTCAATGCTCCCGTCATAAGTGAGCTTTCCGACCAAGCCACAACAAGCTTGCAAGAGCTGGGCGCCTGGTCAGAT
GGCATTCAAGTCAATTTCCAGGCATCGGGCCACGCTGTCACAAGCCAGCATTTTATTGGAACAGACGAGGGAGAC
ACCGACACACTGCTACTTGATACGGTAGTCACGGGCAACCTCGAGTCGTTGCGCGATCTCCTCGCCAAGATGCAG
ACGACTGTTGAGTCGAGTCAAGGCGATAGTTCCTTGTCGGACCGCTTGACCCGCACCTTTTTGGCCGCCATTCAT
GAGGCGCCCCAAGAGGCCCTAGAGGTGCTGCTTGACACGGGCCTTGTTGACCTCAACTCGTACGACGACATCAAC
GAGAGGAATTGCCTACACCAGGCAGCAATCTATGGCAAGGAGCATGTCCTGGCCTGGGGCCTTGAAGCTGGCGTC
TTGGCCGACAGAACAGACGTCTATGGGCGAGTTCCGCTGCACTATGCCAGCTTGCATGGACGACTGGAAATGCTC
GAGGCCTTGCTCAATGCAAACGGACAAACAATCAATTTCATTGACCACGACAATTTTACTCCTCTGATACACTCC
ATCATTCACGGCAACCTTGACTGCATTCAACGCCTGCTGGCCAAGTCAGCACGCATTGACCCCGTGTCAGATTCA
GATCACGTCCCCTTGAACCTGGCTTGTGAGCACGGCTCGGAACCAGTGGTGGAGTTGTTGCTGCAGCACGGAGCA
CGAATTCTGTCAGATGCTGAGGGCTTGTATCCCCAGCATCTGGTGGCACGGGCGGGAAAGTCGTCTCAGTTGCTT
TTGCTGCTAAAGCACTATGGTGCAGACTTGGATCAGATGGACAAGCTCTACGGCTGGACTCCGCTAGTGCATGCC
GCCAGCGAGGGCAACGCTGACTGTCTGCAAGCCTTGCTCAAGCTTGGTGTCGATGTCAACATTGTTGATGAAAAA
GATCTGCCGGCAATGTACTATGCGGCTTGGGAGGGGCATTTGGGCTGCATGAAGCTGCTCGCACGTTACACGGCG
CACAACAAAACGAGCCCCATGGCTGTACAGCCACCGCTGGGATCCACGAGGACAAGCGATGCGCCAGTTCCCATG
TCACTCGACCCCGACGCCATTCCCATCCTCGAGCTACCGCCACCAATCATCCCCCTGCGCAGATATGGCCACAAC
TTTCTCGACACCAAGACTGTCATACAAATAAGCTTTGACGATGCACAGCATCCGCCCTTGGTGTTTTTCCAAGAT
GGCAAGTATCCCGCGGCGCGCCTCACAATCTCTTCCAAGGTGTCGGATCTCATACCCAAGAATATCATACTTCCC
ATTCAGGAAGACACGCGCATTGTGTCGTTTCAAGTGGATAATATAGACACCTTTTCCCTCGATTTTGACGTCTTC
CCGACGTATGGCGCCAAGGTTATTGCCAAGACGGTTGTATTGCCAAGTGCCTTTAAATCTCAAGGATGCTCAAGC
TGCTGTCTGCCCCTGTTCGATCCTCGCTTGCGGGCAATAGGGCAGATCAGTTTCAGCACCCAGGTCATCAAGCCC
TTTCAGGGTCAACCACTTGAGATTACAGATTTTGAAACGTACTGGAAAGCTACGAGCCAGTTGAACCAACCGACT
AGCGCCATTGTGACGGGGTCAAGCCTTTCTGGTGACTACGTGAGGCTCTACGTACAGCACACGAGCGATGGTGTG
CCCGTCATATGGCCTCGATGGACCATTGTCTGCGGAGGGCTCGACATTGCAGTCTGCCACTTGTCACTAGACCAG
TTCCTGGCCATTACAGCCAAGAGTGAGAGTCGGGCCAAGCTGGTCAGTCTGCCCTCCAAGACGACGGACGATATT
GCGCAGATATACGAAATTGTGGCCACGGCGGGATTGACGCTGACCAAGGCTTTGTCGATATTGCCGTTGGGGGTA
CACGTCAATCTTCAAATTCTTTATCCGACGGCCGAGGAAGAGCGCGAGCTTGCTTTGGGACCAGCCATGGACGTC
AATGTTTTTGTTGATGCCATCCTCACAGCCGTCTTTGACCACGCGCGTGCGCAAAGAGCACAGTTCCAGTCGCCA
GATGTGGCTCGTTCCATGGTGTTTAGCAGTTACAATGCCGACCTGTGCACAGCTCTTAACTGGAAGCAACCCAAT
TTTCCCGTCTTTCTCTGCAACGACTTGGGCAGAGAAAAGGGGCAATGCGGGACAAGCAGCAAGGCGGAGAGAAAA
AGTATGTCGGTAAAAGAGGCGGTGCGGATAGCACAGAGCAACAATTTCATGGGCCTCATGTGCTACTCGCAACTA
TTGGACTTGGTTCCTGCCTTGATCGACGCTATCAAGTCACATGGCTTGGCTCTTGTAATGGATAAGTCGACGGAC
GTTCCTGAGACGAATGTAGATGGCAACCCGTTTCCTCGACTGCCTAGTGGCGTGGATGGTGTGCTGAAAAATCAT
GGCATTTTAAGGTTTCACGATTCTATAGACATTTAG
Gene >OphauB2|5126
ATGCCCGGGGGGTCTGCTTACCGCATCTAACTTACTATTGCCTTGCAGGAAGTTTGGCAAGCAGATCCAGAAGCG
CCAGCTCGAGATTCCCGAATACGCCGCCAGCTTTGTCAATTACAAGGCTCTCAAAAAGGTATTCCATGGACCCTT
CATCTTGGCGCCCGGGGGTAGCGGAGCAGCTTGAGCCCAAGCAACAGACGGCTTGGCACACGAGTCCAAAATCCG
CCCTCACTGTCTCGTCTTTCCGCCTTGCCACGCGAGATATCCCTGGCTGGACAAGTGTCACTGACTCTGGCTGTC
GTCTAGCTCATCAAGAAGCGTTCCATTACGCCCACGCTTGTCGCTCAAAATGGAATTGACGCCTCCGCCACATCG
GTCGACTCGCAGACGGCTTTGCAAGTCAACAAGGCCACCTTCTTCTTTCAATTAGTATGTCTTGCAGAGGCGAGC
TGGCGTCAAAAAAACGACTCATTGACGTGCATAGGAGCGCGAACTTGACAAGGTCAACGCCTTCTACCTGCAAAA
GGAAGCCGAGGTTGGCCCTCGCTCGCCCTGGACCCGTCTTGATGCCGTCGCTGACGCATTACCCCTGCTGTAGCT
CAAGATACGTCTCAAGACGCTGTTGGACAAGAAAAAGGTGCTACAGACTCGCCAGGGCTTTTCGCGCCGCTCCTC
CAAGTTCACCACGCTAGAAGAGGGCTTCCAGCAGTTTGCAACAGATCTGAGCAAGCTGCAGCAGTTTGTCGAGAT
CAATGGAACGGCTTTTTCTAAAATACTCAAAAAGTGGGACAAGACGTCAAAGTCCAAGACAAAGGAGCTTTACTT
GTCGCGGGCTGTCGAGGTGCAGCCCTTTTTCAATGCTCCCGTCATAAGTGAGCTTTCCGACCAAGCCACAACAAG
CTTGCAAGAGCTGGGCGCCTGGTCAGATGGCATTCAAGTCAATTTCCAGGCATCGGGCCACGCTGTCACAAGCCA
GCATTTTATTGGAACAGACGAGGGAGACACCGACACACTGCTACTTGATACGGTAGTCACGGGCAACCTCGAGTC
GTTGCGCGATCTCCTCGCCAAGATGCAGACGACTGTTGAGTCGAGTCAAGGCGATAGTTCCTTGTCGGACCGCTT
GACCCGCACCTTTTTGGCCGCCATTCATGAGGCGCCCCAAGAGGCCCTAGAGGTGCTGCTTGACACGGGCCTTGT
TGACCTCAACTCGTACGACGACATCAACGAGAGGAATTGCCTACACCAGGCAGCAATCTATGGCAAGGAGCATGT
CCTGGCCTGGGGCCTTGAAGCTGGCGTCTTGGCCGACAGAACAGACGTCTATGGGCGAGTTCCGCTGCACTATGC
CAGCTTGCATGGACGACTGGAAATGCTCGAGGCCTTGCTCAATGGTGAGTCGTCTGGGCCATGGCAGTCACTGGC
AGGACTGACATGCCGAAGCAAACGGACAAACAATCAATTTCATTGACCACGACAATTTTACTCCTCTGATACACT
CCATCATTCACGGCAACCTTGACTGCATTCAACGCCTGCTGGCCAAGTCAGCACGCATTGACCCCGTGTCAGATT
CAGATCACGTCCCCTTGAACCTGGCTTGTGAGCACGGCTCGGAACCAGTGGTGGAGTTGTTGCTGCAGCACGGAG
CACGAATTCTGTCAGATGCTGAGGGCTTGTATCCCCAGCATCTGGTGGCACGGGCGGGAAAGTCGTCTCAGTTGC
TTTTGCTGCTAAAGCACTATGGTGCAGACTTGGATCAGATGGACAAGCTCTACGGCTGGACTCCGCTAGTGCATG
CCGCCAGCGAGGGCAACGCTGACTGTCTGCAAGCCTTGCTCAAGCTTGGTGTCGATGTCAACATTGTTGATGAAA
AAGATCTGCCGGCAATGTACTATGCGGCTTGGGAGGGGCATTTGGGCTGCATGAAGCTGCTCGCACGTTACACGG
CGCACAACAAAACGAGCCCCATGGCTGTACAGCCACCGCTGGGATCCACGAGGACAAGCGATGCGCCAGTTCCCA
TGTCACTCGACCCCGACGCCATTCCCATCCTCGAGCTACCGCCACCAATCATCCCCCTGCGCAGATATGGCCACA
ACTTTCTCGACACCAAGACTGTCATACAAATAAGCTTTGACGATGCACAGCATCCGCCCTTGGTGTTTTTCCAAG
ATGGCAAGTATCCCGCGGCGCGCCTCACAATCTCTTCCAAGGTGTCGGATCTCATACCCAAGAATATCATACTTC
CCATTCAGGAAGACACGCGCATTGTGTCGTTTCAAGTGGATAATATAGACACCTTTTCCCTCGATTTTGACGTCT
TCCCGACGTATGGCGCCAAGGTTATTGCCAAGACGGTTGTATTGCCAAGTGCCTTTAAATCTCAAGGATGCTCAA
GCTGCTGTCTGCCCCTGTTCGATCCTCGCTTGCGGGCAATAGGGCAGATCAGTTTCAGCACCCAGGTCATCAAGC
CCTTTCAGGGTCAACCACTTGAGATTACAGATTTTGAAACGTACTGGAAAGCTACGAGCCAGTTGAACCAACCGA
CTAGCGCCATTGTGACGGGGTCAAGCCTTTCTGGTGACTACGTGAGGCTCTACGTACAGCACACGAGCGATGGTG
TGCCCGTCATATGGCCTCGATGGACCATTGTCTGCGGAGGGCTCGACATTGCAGTCTGCCACTTGTCACTAGACC
AGTTCCTGGCCATTACAGCCAAGAGTGAGAGTCGGGCCAAGCTGGTCAGTCTGCCCTCCAAGACGACGGACGATA
TTGCGCAGATATACGAAATTGTGGCCACGGCGGGATTGACGCTGACCAAGGCTTTGTCGATATTGCCGTTGGGGG
TACACGTCAATCTTCAAATTCTTTATCCGACGGCCGAGGAAGAGCGCGAGCTTGCTTTGGGACCAGCCATGGACG
TCAATGTTTTTGTTGATGCCATCCTCACAGCCGTCTTTGACCACGCGCGTGCGCAAAGAGCACAGTTCCAGTCGC
CAGATGTGGCTCGTTCCATGGTGTTTAGCAGTTACAATGCCGACCTGTGCACAGCTCTTAACTGGAAGCAACCCA
ATTTTCCCGTCTTTCTCTGCAACGACTTGGGCAGAGAAAAGGGGCAATGCGGGACAAGCAGCAAGGCGGAGAGAA
AAAGTATGTCGGTAAAAGAGGCGGTGCGGATAGCACAGAGCAACAATTTCATGGGCCTCATGTGCTACTCGCAAC
TATTGGTTAGTTTGGCTTTGCGTTTGCTGTTTTGATGGAGAGACTAACTTGTCAAATCTAGGACTTGGTTCCTGC
CTTGATCGACGCTATCAAGTCACATGGCTTGGCTCTTGTAATGGATAAGTCGACGGACGTTCCTGAGACGAATGT
AGATGGCAACCCGTTTCCTCGACTGCCTAGTGGCGTGGATGGTGTGCTGAAAAATCATGGCATTTTAAGGTTTCA
CGATTCTATAGACATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail