Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5121
Gene name
LocationContig_38:87149..88538
Strand-
Gene length (bp)1389
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13695|YEN1_SCHPO Uncharacterized serine-rich protein C11G7.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11G7.01 PE=4 SV=1 221 282 3.0E-08
sp|Q8JSZ3|GP_CCHFI Envelopment polyprotein OS=Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) GN=GP PE=3 SV=1 17 227 4.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 235 257 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5121
MSSGATSLLNSNPGGSTTPTSAPAQAPSQQSSPPAAGGGSGATSTPDASGSSQQQQQPSSTAPSPPVAPSSSAPP
ADATPSSNQQQSNAPPPATPTQPSQQPPPRPTPTPPQNSTPNSPAPGVSTPAPPASTPPSDPSQGQPPPPASSSS
QDNAPAPTSSSPPSSSPQPEGPSSNVITITNSDTTATSFQVITSTTTQQPGGSTPTATTTSSTSSATPIDPSDQG
SSGLSQGSKVAIGVVVPIAAIALLVLVGLWLWKKRRARQEAEEERRKEVEDYAYNPNADPTMPAVGPDNSYEMRE
EGSAGYRGWGSTTAAGSGRKASTTMSGGRATGGAYSDASPTRGHASETRSGEALMDGSSSPDGEILGAMGPSASN
NRSSDVRRGPSNASSSYSAARSDGSDGGLYGNGASYYEQYGQNPYNDARPQELPGQAVIRDNPARRNTRIENPAH
FPQQSSGIAQNF*
Coding >OphauB2|5121
ATGTCGTCGGGCGCAACCAGCCTGCTAAACTCCAACCCCGGAGGGTCGACGACGCCCACGAGTGCGCCTGCTCAA
GCGCCATCGCAGCAGTCGTCTCCCCCGGCTGCTGGCGGAGGCAGTGGTGCCACGTCGACGCCCGACGCCTCGGGC
TCGTCTCAGCAGCAGCAGCAGCCGTCATCGACTGCCCCGTCGCCGCCTGTTGCTCCCTCGTCCTCGGCGCCGCCC
GCTGATGCGACTCCCTCGTCCAACCAACAGCAATCCAATGCTCCACCGCCTGCTACCCCAACCCAGCCCTCACAA
CAGCCACCTCCAAGGCCAACGCCTACGCCACCGCAAAACTCGACGCCAAACTCGCCTGCTCCCGGAGTCTCGACA
CCCGCTCCTCCTGCTAGCACGCCCCCTTCGGACCCCAGCCAGGGGCAGCCGCCGCCGCCAGCGAGCTCGTCGTCA
CAGGACAATGCTCCGGCGCCAACGTCTTCATCGCCGCCGTCTTCATCGCCTCAGCCTGAAGGCCCCTCTTCCAAT
GTCATCACCATCACAAACAGCGACACCACGGCCACGAGCTTCCAAGTCATCACTTCCACCACTACTCAACAGCCC
GGCGGCTCTACTCCTACGGCCACGACGACTTCGTCCACTTCGAGTGCCACCCCCATCGATCCATCTGACCAAGGA
AGCAGCGGCCTGTCGCAGGGCTCCAAGGTGGCTATTGGTGTGGTTGTGCCTATTGCTGCCATTGCACTGCTTGTA
CTTGTTGGCCTTTGGCTGTGGAAGAAGCGTCGAGCTCGCCAGGAGGCTGAAGAGGAGCGTCGAAAAGAGGTGGAG
GATTACGCCTACAATCCCAATGCTGACCCTACCATGCCCGCCGTTGGGCCAGACAATTCGTATGAAATGAGGGAG
GAAGGTTCTGCCGGCTATCGCGGCTGGGGCTCCACCACGGCTGCAGGCTCAGGACGCAAAGCCTCGACTACCATG
TCTGGAGGCCGGGCCACGGGTGGCGCGTATTCGGATGCATCTCCCACGCGTGGCCACGCCTCGGAGACTCGCTCC
GGCGAGGCTTTGATGGACGGCTCCTCGTCGCCCGACGGAGAGATTCTTGGCGCCATGGGACCTTCGGCTTCCAAC
AATCGTAGCAGCGATGTGCGCCGAGGCCCGTCAAATGCCTCATCATCCTATAGTGCAGCCCGCTCTGACGGTTCT
GACGGCGGCTTGTACGGCAATGGCGCGTCCTACTATGAGCAGTATGGGCAGAATCCCTACAACGATGCGCGACCC
CAAGAGTTGCCGGGACAGGCTGTCATTCGCGACAATCCTGCTCGACGCAACACACGCATTGAAAATCCGGCTCAC
TTTCCCCAGCAGAGCTCAGGAATTGCTCAGAACTTTTGA
Transcript >OphauB2|5121
ATGTCGTCGGGCGCAACCAGCCTGCTAAACTCCAACCCCGGAGGGTCGACGACGCCCACGAGTGCGCCTGCTCAA
GCGCCATCGCAGCAGTCGTCTCCCCCGGCTGCTGGCGGAGGCAGTGGTGCCACGTCGACGCCCGACGCCTCGGGC
TCGTCTCAGCAGCAGCAGCAGCCGTCATCGACTGCCCCGTCGCCGCCTGTTGCTCCCTCGTCCTCGGCGCCGCCC
GCTGATGCGACTCCCTCGTCCAACCAACAGCAATCCAATGCTCCACCGCCTGCTACCCCAACCCAGCCCTCACAA
CAGCCACCTCCAAGGCCAACGCCTACGCCACCGCAAAACTCGACGCCAAACTCGCCTGCTCCCGGAGTCTCGACA
CCCGCTCCTCCTGCTAGCACGCCCCCTTCGGACCCCAGCCAGGGGCAGCCGCCGCCGCCAGCGAGCTCGTCGTCA
CAGGACAATGCTCCGGCGCCAACGTCTTCATCGCCGCCGTCTTCATCGCCTCAGCCTGAAGGCCCCTCTTCCAAT
GTCATCACCATCACAAACAGCGACACCACGGCCACGAGCTTCCAAGTCATCACTTCCACCACTACTCAACAGCCC
GGCGGCTCTACTCCTACGGCCACGACGACTTCGTCCACTTCGAGTGCCACCCCCATCGATCCATCTGACCAAGGA
AGCAGCGGCCTGTCGCAGGGCTCCAAGGTGGCTATTGGTGTGGTTGTGCCTATTGCTGCCATTGCACTGCTTGTA
CTTGTTGGCCTTTGGCTGTGGAAGAAGCGTCGAGCTCGCCAGGAGGCTGAAGAGGAGCGTCGAAAAGAGGTGGAG
GATTACGCCTACAATCCCAATGCTGACCCTACCATGCCCGCCGTTGGGCCAGACAATTCGTATGAAATGAGGGAG
GAAGGTTCTGCCGGCTATCGCGGCTGGGGCTCCACCACGGCTGCAGGCTCAGGACGCAAAGCCTCGACTACCATG
TCTGGAGGCCGGGCCACGGGTGGCGCGTATTCGGATGCATCTCCCACGCGTGGCCACGCCTCGGAGACTCGCTCC
GGCGAGGCTTTGATGGACGGCTCCTCGTCGCCCGACGGAGAGATTCTTGGCGCCATGGGACCTTCGGCTTCCAAC
AATCGTAGCAGCGATGTGCGCCGAGGCCCGTCAAATGCCTCATCATCCTATAGTGCAGCCCGCTCTGACGGTTCT
GACGGCGGCTTGTACGGCAATGGCGCGTCCTACTATGAGCAGTATGGGCAGAATCCCTACAACGATGCGCGACCC
CAAGAGTTGCCGGGACAGGCTGTCATTCGCGACAATCCTGCTCGACGCAACACACGCATTGAAAATCCGGCTCAC
TTTCCCCAGCAGAGCTCAGGAATTGCTCAGAACTTTTGA
Gene >OphauB2|5121
ATGTCGTCGGGCGCAACCAGCCTGCTAAACTCCAACCCCGGAGGGTCGACGACGCCCACGAGTGCGCCTGCTCAA
GCGCCATCGCAGCAGTCGTCTCCCCCGGCTGCTGGCGGAGGCAGTGGTGCCACGTCGACGCCCGACGCCTCGGGC
TCGTCTCAGCAGCAGCAGCAGCCGTCATCGACTGCCCCGTCGCCGCCTGTTGCTCCCTCGTCCTCGGCGCCGCCC
GCTGATGCGACTCCCTCGTCCAACCAACAGCAATCCAATGCTCCACCGCCTGCTACCCCAACCCAGCCCTCACAA
CAGCCACCTCCAAGGCCAACGCCTACGCCACCGCAAAACTCGACGCCAAACTCGCCTGCTCCCGGAGTCTCGACA
CCCGCTCCTCCTGCTAGCACGCCCCCTTCGGACCCCAGCCAGGGGCAGCCGCCGCCGCCAGCGAGCTCGTCGTCA
CAGGACAATGCTCCGGCGCCAACGTCTTCATCGCCGCCGTCTTCATCGCCTCAGCCTGAAGGCCCCTCTTCCAAT
GTCATCACCATCACAAACAGCGACACCACGGCCACGAGCTTCCAAGTCATCACTTCCACCACTACTCAACAGCCC
GGCGGCTCTACTCCTACGGCCACGACGACTTCGTCCACTTCGAGTGCCACCCCCATCGATCCATCTGACCAAGGA
AGCAGCGGCCTGTCGCAGGGCTCCAAGGTGGCTATTGGTGTGGTTGTGCCTATTGCTGCCATTGCACTGCTTGTA
CTTGTTGGCCTTTGGCTGTGGAAGAAGCGTCGAGCTCGCCAGGAGGCTGAAGAGGAGCGTCGAAAAGAGGTGGAG
GATTACGCCTACAATCCCAATGCTGACCCTACCATGCCCGCCGTTGGGCCAGACAATTCGTATGAAATGAGGGAG
GAAGGTTCTGCCGGCTATCGCGGCTGGGGCTCCACCACGGCTGCAGGCTCAGGACGCAAAGCCTCGACTACCATG
TCTGGAGGCCGGGCCACGGGTGGCGCGTATTCGGATGCATCTCCCACGCGTGGCCACGCCTCGGAGACTCGCTCC
GGCGAGGCTTTGATGGACGGCTCCTCGTCGCCCGACGGAGAGATTCTTGGCGCCATGGGACCTTCGGCTTCCAAC
AATCGTAGCAGCGATGTGCGCCGAGGCCCGTCAAATGCCTCATCATCCTATAGTGCAGCCCGCTCTGACGGTTCT
GACGGCGGCTTGTACGGCAATGGCGCGTCCTACTATGAGCAGTATGGGCAGAATCCCTACAACGATGCGCGACCC
CAAGAGTTGCCGGGACAGGCTGTCATTCGCGACAATCCTGCTCGACGCAACACACGCATTGAAAATCCGGCTCAC
TTTCCCCAGCAGAGCTCAGGAATTGCTCAGAACTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail