Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5120
Gene name
LocationContig_38:85232..86252
Strand+
Gene length (bp)1020
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
CBM66 2.3E-22 136 266

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7045
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1480
Ophiocordyceps australis map64 (Brazil) OphauB2|5120 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4905

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5120
MRNTDKSCQRGEEEWTYEYTCGRTCYSHLGKWGLPVKSGDCDTQDENCRVATSGAVDNIECVKRGIKRELTLADW
FEKTDATQWDIYGKKGVFVRMGSGVLATKAPGSKAILNFTSKHDPDTRWGQGILTKGARDANVHDFVFASNLTFP
VKSKPVNAGLVFRVSNPGHGVDEYKGYYTGIEWAGVGSATRLVLGAAHNNWRHIRAADLGVMTKSSFVIKVEAVG
SLIKIFVDDVEKPLIEVHDQTFKRGRVGLRTFKVQVQYSNIEFKRIRD*
Coding >OphauB2|5120
ATGAGAAATACTGACAAAAGCTGCCAAAGGGGCGAAGAAGAATGGACATATGAATACACGTGCGGAAGAACATGC
TATTCCCATCTCGGCAAATGGGGCTTGCCAGTCAAGTCTGGAGACTGCGATACCCAAGATGAAAACTGTCGAGTG
GCAACAAGCGGCGCTGTAGATAACATTGAATGCGTCAAGAGAGGAATCAAGCGCGAGCTCACCCTTGCCGATTGG
TTTGAAAAGACTGACGCCACTCAATGGGACATTTACGGCAAAAAGGGAGTCTTTGTTCGCATGGGCTCTGGTGTC
TTGGCCACAAAAGCCCCAGGCAGCAAAGCCATCCTCAACTTCACGTCCAAGCATGACCCAGACACACGATGGGGC
CAGGGGATTCTGACCAAGGGCGCCAGGGACGCCAATGTGCACGACTTTGTCTTTGCCAGCAACTTGACGTTTCCC
GTCAAGTCGAAGCCAGTCAATGCCGGCCTAGTGTTCCGCGTGTCCAATCCAGGCCATGGTGTCGACGAGTACAAA
GGCTACTATACTGGCATTGAATGGGCTGGAGTCGGCTCTGCTACACGCCTTGTGCTAGGTGCCGCCCACAACAAC
TGGAGACATATCAGGGCCGCTGATTTGGGCGTCATGACAAAGTCAAGCTTCGTCATCAAGGTCGAGGCGGTTGGA
TCCTTGATCAAGATATTCGTTGATGATGTGGAAAAGCCCTTGATCGAGGTTCACGACCAGACGTTTAAAAGAGGC
CGAGTTGGCCTGCGAACGTTTAAAGTGCAAGTCCAGTACTCCAATATCGAATTCAAACGCATCCGCGATTAG
Transcript >OphauB2|5120
ATGAGAAATACTGACAAAAGCTGCCAAAGGGGCGAAGAAGAATGGACATATGAATACACGTGCGGAAGAACATGC
TATTCCCATCTCGGCAAATGGGGCTTGCCAGTCAAGTCTGGAGACTGCGATACCCAAGATGAAAACTGTCGAGTG
GCAACAAGCGGCGCTGTAGATAACATTGAATGCGTCAAGAGAGGAATCAAGCGCGAGCTCACCCTTGCCGATTGG
TTTGAAAAGACTGACGCCACTCAATGGGACATTTACGGCAAAAAGGGAGTCTTTGTTCGCATGGGCTCTGGTGTC
TTGGCCACAAAAGCCCCAGGCAGCAAAGCCATCCTCAACTTCACGTCCAAGCATGACCCAGACACACGATGGGGC
CAGGGGATTCTGACCAAGGGCGCCAGGGACGCCAATGTGCACGACTTTGTCTTTGCCAGCAACTTGACGTTTCCC
GTCAAGTCGAAGCCAGTCAATGCCGGCCTAGTGTTCCGCGTGTCCAATCCAGGCCATGGTGTCGACGAGTACAAA
GGCTACTATACTGGCATTGAATGGGCTGGAGTCGGCTCTGCTACACGCCTTGTGCTAGGTGCCGCCCACAACAAC
TGGAGACATATCAGGGCCGCTGATTTGGGCGTCATGACAAAGTCAAGCTTCGTCATCAAGGTCGAGGCGGTTGGA
TCCTTGATCAAGATATTCGTTGATGATGTGGAAAAGCCCTTGATCGAGGTTCACGACCAGACGTTTAAAAGAGGC
CGAGTTGGCCTGCGAACGTTTAAAGTGCAAGTCCAGTACTCCAATATCGAATTCAAACGCATCCGCGATTAG
Gene >OphauB2|5120
ATGAGAAATACTGACGTTTGGAGCACAGGATTTCTTGGATGACAACAACTGCTTCAAGGTTACGTATGATTGGGG
TGTAGATGGCACTGGCTACTGCCCTCCCAAGGCAAGACGGCTTCCCATGACGATGTGCAGAATGATGCTGACATG
GATGGGCTTGATAGAAAAGCTGCCAAAGGGGCGAAGAAGAATGGACATATGAATACACGTGCGGAAGAACATGCT
ATTCCCATCTCGGCAAATGGGGCTTGCCAGTCAAGTCTGGAGACTGCGATACCCAAGATGAAAACTGTCGAGTGG
CAACAAGCGGCGCTGTAGATAACATTGAATGCGTCAAGGTGAGTTGCTTCTTGTCCGTCATGGGCGCGTGCTAAG
CCATGGCTATAGAGAGGAATCAAGCGCGAGCTCACCCTTGCCGATTGGTTTGAAAAGACTGACGCCACTCAATGG
GACATTTACGGCAAAAAGGGAGTCTTTGTTCGCATGGGCTCTGGTGTCTTGGCCACAAAAGCCCCAGGCAGCAAA
GCCATCCTCAACTTCACGTCCAAGCATGACCCAGACACACGATGGGGCCAGGGGATTCTGACCAAGGGCGCCAGG
GACGCCAATGTGCACGACTTTGTCTTTGCCAGCAACTTGACGTTTCCCGTCAAGTCGAAGCCAGTCAATGCCGGC
CTAGTGTTCCGCGTGTCCAATCCAGGCCATGGTGTCGACGAGTACAAAGGCTACTATACTGGCATTGAATGGGCT
GGAGTCGGCTCTGCTACACGCCTTGTGCTAGGTGCCGCCCACAACAACTGGAGACATATCAGGGCCGCTGATTTG
GGCGTCATGACAAAGTCAAGCTTCGTCATCAAGGTCGAGGCGGTTGGATCCTTGATCAAGATATTCGTTGATGAT
GTGGAAAAGCCCTTGATCGAGGTTCACGACCAGACGTTTAAAAGAGGCCGAGTTGGCCTGCGAACGTTTAAAGTG
CAAGTCCAGTACTCCAATATCGAATTCAAACGCATCCGCGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail