Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5116
Gene name
LocationContig_38:72946..75261
Strand-
Gene length (bp)2315
Transcript length (bp)2178
Coding sequence length (bp)2178
Protein length (aa) 726

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 8.3E-19 600 668

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 259 281 22
2 313 335 22
3 372 394 22
4 409 431 22
5 553 575 22
6 595 617 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5116
MNYQRLESNDDPSCNDSLSHDLAHSHPGRRRQQVNLDRLAASSSHPSAPPFQPKPRAKMQDANQHSALDPLLPSW
NEASDKSAPAVPVVRLRDAQLAMLAAGNAALAMNIKDELALAAGRVTPGVDDTPYIQYALEVLGRDTKRHSEQLW
PHDSSRKGTYSLAETPDMASTERPELPSHLLRLSRGARRGSATRTSLMDSETDPNRPLGASEEPLSTRTPTRRTH
PSKPEKWIPVDKCSLQTIDPRGKTYPPLTFKPCILRPFSMMCLILSCLLMAAALVFSNRYSTHHAGLTPYPGSIY
SGQYFAFRILPQLLASFILLFAQNIVTASLRIIPFTLMAREDPRDRYLALFTRLYPKSFLFPQLMGPWQLRLFNV
ATWLAILTVPLQSAAFTCIYVQDRWIWAPSQGVMWALVALYFILLLSTAMLMAFWFRQWTGLRWDIRSIAHLIPL
LNRTNTLRSYTRTGLFDPRTNAKAEMRSRWFDRLGYWQTEGLSTGGLWHSIGTSAMPPDHEPVPHGEHAKRESSD
DSPGSEGFTTLGNHGGDYIPWCLRDAPLLSLAMVTSILLMALLVVSFLPQTRLEDGFVPRLSAKPNQAAFSAANF
VYSFVPSLIGMLLFLIFQKMDQSLRILQPWAELSKVNGASARCSILADYVACLPLQATCRALGNGHWRDGQQSSD
VPEYANVRDFAGVPPTLRGLCVAASAAPTSIVAASFCHIGGRHYRAMLCR*
Coding >OphauB2|5116
ATGAATTATCAACGTCTTGAGTCCAATGACGACCCATCTTGTAATGATAGCTTGTCGCACGACCTCGCCCATTCT
CACCCAGGTCGGCGCCGTCAGCAAGTCAACTTGGACCGCCTTGCTGCCTCATCCTCACACCCTTCTGCCCCGCCA
TTCCAGCCAAAACCGCGTGCCAAAATGCAAGATGCAAATCAACATTCTGCCCTAGACCCTCTCTTGCCTTCGTGG
AATGAAGCTAGTGACAAGTCAGCCCCAGCAGTTCCTGTGGTGCGCTTGAGAGACGCTCAACTAGCTATGCTGGCT
GCGGGCAATGCTGCTCTGGCCATGAACATCAAGGACGAGCTGGCCCTTGCGGCTGGAAGGGTTACTCCTGGCGTC
GACGACACGCCCTATATCCAATATGCATTGGAAGTCCTTGGTCGAGACACAAAGCGTCATTCCGAGCAACTGTGG
CCACACGACAGCTCACGCAAAGGCACGTACAGCCTTGCAGAGACACCTGACATGGCCAGCACAGAGCGCCCCGAA
CTACCTAGCCATCTACTGCGCCTTTCTCGTGGCGCCAGACGTGGCTCTGCGACACGTACCAGCCTGATGGACTCT
GAGACAGACCCTAACAGGCCTCTCGGCGCTTCGGAGGAACCCCTTTCGACAAGGACACCAACAAGACGAACTCAC
CCGTCTAAGCCTGAAAAATGGATTCCTGTCGACAAGTGCAGTCTGCAAACCATTGATCCTCGCGGCAAGACATAT
CCACCTCTCACCTTCAAGCCTTGCATTTTGCGACCCTTTTCCATGATGTGCCTGATTCTATCATGCCTTCTCATG
GCTGCAGCTCTTGTATTTTCCAACAGATACTCGACGCATCATGCCGGATTGACACCTTACCCCGGCAGCATATAT
TCGGGCCAATATTTTGCTTTTCGAATTCTACCGCAGCTCCTCGCGTCATTTATACTACTCTTCGCGCAAAACATC
GTCACTGCATCACTTCGCATAATCCCATTTACCCTCATGGCGAGAGAAGATCCCCGCGACCGTTATCTTGCCTTG
TTCACACGTCTCTATCCAAAATCCTTTTTGTTTCCGCAACTCATGGGGCCTTGGCAACTGAGACTCTTCAATGTA
GCCACTTGGCTAGCAATTCTCACCGTTCCACTACAGAGCGCCGCTTTCACATGCATCTATGTTCAAGACAGGTGG
ATTTGGGCGCCGTCTCAGGGGGTAATGTGGGCACTTGTTGCCCTGTACTTTATTCTTCTGCTCTCAACGGCCATG
TTGATGGCTTTTTGGTTCCGGCAGTGGACAGGACTTCGGTGGGACATTCGATCGATTGCACATCTAATTCCACTC
CTGAACCGCACCAATACGCTGCGCAGCTACACCCGCACAGGCCTTTTCGACCCTAGAACCAATGCCAAGGCTGAA
ATGCGTTCTCGTTGGTTTGATCGACTAGGATACTGGCAAACCGAGGGCCTGAGTACAGGCGGTCTCTGGCACAGC
ATTGGAACATCAGCCATGCCCCCAGACCACGAACCCGTGCCTCATGGTGAGCACGCCAAGAGGGAAAGCTCGGAT
GATTCTCCTGGCTCCGAGGGATTTACTACTCTGGGAAATCATGGGGGGGATTACATTCCATGGTGCCTAAGAGAC
GCACCGCTTCTGAGCCTTGCCATGGTGACGAGTATACTGCTCATGGCGTTGCTCGTCGTGTCATTTTTACCCCAG
ACGCGGCTGGAGGATGGCTTTGTTCCTCGACTATCAGCAAAGCCCAACCAGGCAGCCTTTTCAGCTGCCAACTTT
GTCTATAGCTTTGTCCCATCGCTCATCGGCATGTTGCTTTTCTTGATCTTTCAGAAGATGGATCAATCATTGCGC
ATCCTGCAGCCATGGGCAGAATTATCAAAGGTCAATGGGGCATCGGCACGATGCTCCATCTTGGCTGATTACGTG
GCCTGTCTTCCGCTGCAAGCAACGTGCAGGGCCCTCGGCAATGGACATTGGCGCGACGGACAACAAAGTTCGGAT
GTTCCCGAGTATGCCAATGTTCGGGATTTTGCTGGCGTTCCTCCTACTCTACGTGGTCTGTGTGTTGCTGCTAGT
GCCGCGCCGACATCAATTGTTGCTGCCTCATTCTGTCACATCGGTGGCCGCCATTATCGGGCTATGCTCTGCCGA
TGA
Transcript >OphauB2|5116
ATGAATTATCAACGTCTTGAGTCCAATGACGACCCATCTTGTAATGATAGCTTGTCGCACGACCTCGCCCATTCT
CACCCAGGTCGGCGCCGTCAGCAAGTCAACTTGGACCGCCTTGCTGCCTCATCCTCACACCCTTCTGCCCCGCCA
TTCCAGCCAAAACCGCGTGCCAAAATGCAAGATGCAAATCAACATTCTGCCCTAGACCCTCTCTTGCCTTCGTGG
AATGAAGCTAGTGACAAGTCAGCCCCAGCAGTTCCTGTGGTGCGCTTGAGAGACGCTCAACTAGCTATGCTGGCT
GCGGGCAATGCTGCTCTGGCCATGAACATCAAGGACGAGCTGGCCCTTGCGGCTGGAAGGGTTACTCCTGGCGTC
GACGACACGCCCTATATCCAATATGCATTGGAAGTCCTTGGTCGAGACACAAAGCGTCATTCCGAGCAACTGTGG
CCACACGACAGCTCACGCAAAGGCACGTACAGCCTTGCAGAGACACCTGACATGGCCAGCACAGAGCGCCCCGAA
CTACCTAGCCATCTACTGCGCCTTTCTCGTGGCGCCAGACGTGGCTCTGCGACACGTACCAGCCTGATGGACTCT
GAGACAGACCCTAACAGGCCTCTCGGCGCTTCGGAGGAACCCCTTTCGACAAGGACACCAACAAGACGAACTCAC
CCGTCTAAGCCTGAAAAATGGATTCCTGTCGACAAGTGCAGTCTGCAAACCATTGATCCTCGCGGCAAGACATAT
CCACCTCTCACCTTCAAGCCTTGCATTTTGCGACCCTTTTCCATGATGTGCCTGATTCTATCATGCCTTCTCATG
GCTGCAGCTCTTGTATTTTCCAACAGATACTCGACGCATCATGCCGGATTGACACCTTACCCCGGCAGCATATAT
TCGGGCCAATATTTTGCTTTTCGAATTCTACCGCAGCTCCTCGCGTCATTTATACTACTCTTCGCGCAAAACATC
GTCACTGCATCACTTCGCATAATCCCATTTACCCTCATGGCGAGAGAAGATCCCCGCGACCGTTATCTTGCCTTG
TTCACACGTCTCTATCCAAAATCCTTTTTGTTTCCGCAACTCATGGGGCCTTGGCAACTGAGACTCTTCAATGTA
GCCACTTGGCTAGCAATTCTCACCGTTCCACTACAGAGCGCCGCTTTCACATGCATCTATGTTCAAGACAGGTGG
ATTTGGGCGCCGTCTCAGGGGGTAATGTGGGCACTTGTTGCCCTGTACTTTATTCTTCTGCTCTCAACGGCCATG
TTGATGGCTTTTTGGTTCCGGCAGTGGACAGGACTTCGGTGGGACATTCGATCGATTGCACATCTAATTCCACTC
CTGAACCGCACCAATACGCTGCGCAGCTACACCCGCACAGGCCTTTTCGACCCTAGAACCAATGCCAAGGCTGAA
ATGCGTTCTCGTTGGTTTGATCGACTAGGATACTGGCAAACCGAGGGCCTGAGTACAGGCGGTCTCTGGCACAGC
ATTGGAACATCAGCCATGCCCCCAGACCACGAACCCGTGCCTCATGGTGAGCACGCCAAGAGGGAAAGCTCGGAT
GATTCTCCTGGCTCCGAGGGATTTACTACTCTGGGAAATCATGGGGGGGATTACATTCCATGGTGCCTAAGAGAC
GCACCGCTTCTGAGCCTTGCCATGGTGACGAGTATACTGCTCATGGCGTTGCTCGTCGTGTCATTTTTACCCCAG
ACGCGGCTGGAGGATGGCTTTGTTCCTCGACTATCAGCAAAGCCCAACCAGGCAGCCTTTTCAGCTGCCAACTTT
GTCTATAGCTTTGTCCCATCGCTCATCGGCATGTTGCTTTTCTTGATCTTTCAGAAGATGGATCAATCATTGCGC
ATCCTGCAGCCATGGGCAGAATTATCAAAGGTCAATGGGGCATCGGCACGATGCTCCATCTTGGCTGATTACGTG
GCCTGTCTTCCGCTGCAAGCAACGTGCAGGGCCCTCGGCAATGGACATTGGCGCGACGGACAACAAAGTTCGGAT
GTTCCCGAGTATGCCAATGTTCGGGATTTTGCTGGCGTTCCTCCTACTCTACGTGGTCTGTGTGTTGCTGCTAGT
GCCGCGCCGACATCAATTGTTGCTGCCTCATTCTGTCACATCGGTGGCCGCCATTATCGGGCTATGCTCTGCCGA
TGA
Gene >OphauB2|5116
ATGAATTATCAACGTCTTGAGTCCAATGACGACCCATCTTGTAGTATGAATAGCCAAACTTGATTTTGAAGGTGG
CTTTTTTTTAACAGCTTGCTTTTAGATGATAGCTTGTCGCACGACCTCGCCCATTCTCACCCAGGTCGGCGCCGT
CAGCAAGTCAACTTGGACCGCCTTGCTGCCTCATCCTCACACCCTTCTGCCCCGCCATTCCAGCCAAAACCGCGT
GCCAAAATGCAAGATGCAAATCAACATTCTGCCCTAGACCCTCTCTTGCCTTCGTGGAATGAAGCTAGTGACAAG
TCAGCCCCAGCAGTTCCTGTGGTGCGCTTGAGAGACGCTCAACTAGCTATGCTGGCTGCGGGCAATGCTGCTCTG
GCCATGAACATCAAGGACGAGCTGGCCCTTGCGGCTGGAAGGGTTACTCCTGGCGTCGACGACACGCCCTATATC
CAATATGCATTGGAAGTCCTTGGTCGAGACACAAAGCGTCATTCCGAGCAACTGTGGCCACACGACAGCTCACGC
AAAGGCACGTACAGCCTTGCAGAGACACCTGACATGGCCAGCACAGAGCGCCCCGAACTACCTAGCCATCTACTG
CGCCTTTCTCGTGGCGCCAGACGTGGCTCTGCGACACGTACCAGCCTGATGGACTCTGAGACAGACCCTAACAGG
CCTCTCGGCGCTTCGGAGGAACCCCTTTCGACAAGGACACCAACAAGACGAACTCACCCGTCTAAGCCTGAAAAA
TGGATTCCTGTCGACAAGTGCAGTCTGCAAACCATTGATCCTCGCGGCAAGACATATCCACCTCTCACCTTCAAG
CCTTGCATTTTGCGACCCTTTTCCATGATGTGCCTGATTCTATCATGCCTTCTCATGGCTGCAGCTCTTGTATTT
TCCAACAGATACTCGACGCATCATGCCGGATTGACACCTTACCCCGGCAGCATATATTCGGGCCAATATTTTGCT
TTTCGAATTCTACCGCAGCTCCTCGCGTCATTTATACTACTCTTCGCGCAAAACATCGTCACTGCATCACTTCGC
ATAATCCCATTTACCCTCATGGCGAGAGAAGATCCCCGCGACCGTTATCTTGCCTTGTTCACACGTCTCTATCCA
AAATCCTTTTTGTTTCCGCAACTCATGGGGCCTTGGCAACTGAGACTCTTCAATGTAGCCACTTGGCTAGCAATT
CTCACCGTTCCACTACAGAGCGCCGCTTTCACATGCATCTATGTTCAAGACAGGTGGATTTGGGCGCCGTCTCAG
GGGGTAATGTGGGCACTTGTTGCCCTGTACTTTATTCTTCTGCTCTCAACGGCCATGTTGATGGCTTTTTGGTTC
CGGCAGTGGACAGGACTTCGGTGGGACATTCGATCGATTGCACATCTAATTCCACTCCTGAACCGCACCAATACG
CTGCGCAGCTACACCCGCACAGGCCTTTTCGACCCTAGAACCAATGCCAAGGCTGAAATGCGTTCTCGTTGGTTT
GATCGACTAGGATACTGGCAAACCGAGGGCCTGAGTACAGGCGGTCTCTGGCACAGCATTGGAACATCAGCCATG
CCCCCAGACCACGAACCCGTGCCTCATGGTGAGCACGCCAAGAGGGAAAGCTCGGATGATTCTCCTGGCTCCGAG
GGATTTACTACTCTGGGAAATCATGGGGGGGATTACATTCCATGGTGCCTAAGAGACGCACCGCTTCTGAGCCTT
GCCATGGTGACGAGTATACTGCTCATGGCGTTGCTCGTCGTGTCATTTTTACCCCAGACGCGGCTGGAGGATGGC
TTTGTTCCTCGACTATCAGCAAAGCCCAACCAGGCAGCCTTTTCAGCTGCCAACTTTGTCTATAGCTTTGTCCCA
TCGCTCATCGGCATGTTGCTTTTCTTGATCTTTCAGAAGATGGATCAATCATTGCGCATCCTGCAGCCATGGGCA
GAATTATCAAAGGTCAATGGGGCATCGGCACGATGCTCCATCTTGGCTGATTACGTGGCCTGTCTTCCGCTGCAA
GCAACGTGCAGGGCCCTCGGCAATGGACATTGGCGGTTAGCCATTACAAGCTTGATGTCTGATCTCTTTGTGTTC
ATCCCAATTTTAGCGGGAGGCTTGTTCATGGCGCTTACAGCGACGGACAACAAAGTTCGGATGTTCCCGAGTATG
CCAATGTTCGGGATTTTGCTGGCGTTCCTCCTACTCTACGTGGTCTGTGTGTTGCTGCTAGTGCCGCGCCGACAT
CAATTGTTGCTGCCTCATTCTGTCACATCGGTGGCCGCCATTATCGGGCTATGCTCTGCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail