Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|511
Gene name
LocationContig_109:20108..20809
Strand+
Gene length (bp)701
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08229 SHR3_chaperone ER membrane protein SH3 1.1E-73 18 209

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02774|SHR3_YEAST Secretory component protein SHR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHR3 PE=1 SV=2 14 207 1.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 74 96 22
3 103 125 22
4 163 181 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|511
MAYIDYSKTTRSKNYRGSGSFATFLIIGPTCFFLGILFASFPYDFQLLWTKEPVSDTYYDQLETHLRFMHQSPPL
IGRILNIMMSVGYLGFFSKLFRPSEANFLFDGASLILYTIGVAVYLSNIVRGLRAISANLWESPEFLENAEGRFE
GEFVLGREDSLKVLAASNTILALVLIGVLILQAGQWYAEKRESDDEAAAEAAEKKDKKKQ*
Coding >OphauB2|511
ATGGCCTACATTGATTACTCCAAGACGACGAGGTCCAAGAACTATCGCGGGTCCGGATCATTTGCCACGTTTTTG
ATTATTGGACCGACGTGCTTCTTCCTCGGCATTCTCTTCGCCTCCTTCCCCTACGACTTTCAGTTGCTATGGACT
AAGGAGCCCGTCAGTGACACATATTACGACCAACTCGAGACACACCTGCGCTTCATGCACCAGTCGCCGCCGCTA
ATAGGACGCATCCTCAACATCATGATGAGTGTCGGCTACCTCGGCTTCTTTTCCAAGCTCTTCCGGCCCAGCGAG
GCAAACTTTTTGTTTGACGGCGCATCCCTCATTCTCTACACGATTGGCGTCGCCGTCTATCTCTCCAACATTGTG
CGCGGGCTGCGCGCCATTAGCGCCAACCTTTGGGAGAGTCCCGAGTTTTTGGAAAACGCAGAGGGCCGCTTCGAG
GGCGAGTTTGTCCTGGGCCGCGAGGACAGCCTCAAGGTGCTGGCGGCCAGCAATACCATTTTGGCGCTCGTCCTT
ATTGGCGTGCTCATCCTCCAGGCAGGGCAGTGGTATGCCGAGAAGAGGGAGTCGGATGACGAGGCGGCCGCAGAG
GCGGCGGAGAAGAAGGACAAGAAGAAGCAGTGA
Transcript >OphauB2|511
ATGGCCTACATTGATTACTCCAAGACGACGAGGTCCAAGAACTATCGCGGGTCCGGATCATTTGCCACGTTTTTG
ATTATTGGACCGACGTGCTTCTTCCTCGGCATTCTCTTCGCCTCCTTCCCCTACGACTTTCAGTTGCTATGGACT
AAGGAGCCCGTCAGTGACACATATTACGACCAACTCGAGACACACCTGCGCTTCATGCACCAGTCGCCGCCGCTA
ATAGGACGCATCCTCAACATCATGATGAGTGTCGGCTACCTCGGCTTCTTTTCCAAGCTCTTCCGGCCCAGCGAG
GCAAACTTTTTGTTTGACGGCGCATCCCTCATTCTCTACACGATTGGCGTCGCCGTCTATCTCTCCAACATTGTG
CGCGGGCTGCGCGCCATTAGCGCCAACCTTTGGGAGAGTCCCGAGTTTTTGGAAAACGCAGAGGGCCGCTTCGAG
GGCGAGTTTGTCCTGGGCCGCGAGGACAGCCTCAAGGTGCTGGCGGCCAGCAATACCATTTTGGCGCTCGTCCTT
ATTGGCGTGCTCATCCTCCAGGCAGGGCAGTGGTATGCCGAGAAGAGGGAGTCGGATGACGAGGCGGCCGCAGAG
GCGGCGGAGAAGAAGGACAAGAAGAAGCAGTGA
Gene >OphauB2|511
ATGGCCTACATTGATTACTCCAAGACGACGAGGTCCAAGAACTATCGCGGGTCCGGATCATTTGCCACGTTTTTG
ATTATTGGACGTATGTCTGCTGGCCTTGGATGAGAGAGAAAGAGAAAGATGGAGTGCTGACTCAAGAAACATTGG
CAGCGACGTGCTTCTTCCTCGGCATTCTCTTCGCCTCCTTCCCCTACGACTTTCAGTTGCTATGGACTAAGGAGC
CCGTCAGTGACACATATTACGACCAACTCGAGACACACCTGCGCTTCATGCACCAGTCGCCGCCGCTAATAGGAC
GCATCCTCAACATCATGATGAGTGTCGGCTACCTCGGCTTCTTTTCCAAGCTCTTCCGGCCCAGCGAGGCAAACT
TTTTGTTTGACGGCGCATCCCTCATTCTCTACACGATTGGCGTCGCCGTCTATCTCTCCAACATTGTGCGCGGGC
TGCGCGCCATTAGCGCCAACCTTTGGGAGAGTCCCGAGTTTTTGGAAAACGCAGAGGGCCGCTTCGAGGGCGAGT
TTGTCCTGGGCCGCGAGGACAGCCTCAAGGTGCTGGCGGCCAGCAATACCATTTTGGCGCTCGTCCTTATTGGCG
TGCTCATCCTCCAGGCAGGGCAGTGGTATGCCGAGAAGAGGGAGTCGGATGACGAGGCGGCCGCAGAGGCGGCGG
AGAAGAAGGACAAGAAGAAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail