Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5109
Gene name
LocationContig_38:51712..52706
Strand-
Gene length (bp)994
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 2.2E-29 1 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 1 252 2.0E-24
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 1 252 2.0E-24
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 1 240 3.0E-24
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 1 251 2.0E-23
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 1 252 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 1 252 2.0E-24
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 1 252 2.0E-24
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 1 240 3.0E-24
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 1 251 2.0E-23
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 1 252 3.0E-23
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 1 252 3.0E-23
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 1 251 8.0E-22
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 1 246 4.0E-20
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 1 252 8.0E-20
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 1 252 8.0E-20
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 1 252 8.0E-20
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 1 238 1.0E-19
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 1 246 2.0E-19
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 1 237 4.0E-19
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 1 246 6.0E-19
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 1 224 1.0E-18
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 1 264 2.0E-18
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 1 264 2.0E-18
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 1 264 2.0E-18
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 25 238 1.0E-17
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 25 238 1.0E-17
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 15 248 4.0E-17
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 26 248 9.0E-17
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 1 252 1.0E-16
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 1 252 1.0E-16
sp|O42779|CARP9_CANAX Candidapepsin-9 OS=Candida albicans GN=SAP9 PE=3 SV=1 4 246 4.0E-16
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 1 252 5.0E-16
sp|Q59SU1|CARP9_CANAL Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=1 4 246 3.0E-15
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 15 248 4.0E-15
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 1 240 1.0E-14
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 1 240 1.0E-14
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 1 238 2.0E-13
sp|P40583|YPS6_YEAST Aspartic proteinase yapsin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS6 PE=1 SV=1 16 252 4.0E-12
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 21 240 1.0E-11
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 10 240 2.0E-11
sp|P32834|SXA1_SCHPO Aspartic proteinase sxa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa1 PE=3 SV=2 4 279 3.0E-11
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 3 237 3.0E-11
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 18 237 4.0E-11
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 19 239 4.0E-11
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 21 240 5.0E-11
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 18 239 5.0E-11
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 21 237 7.0E-11
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 18 237 8.0E-11
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 18 239 1.0E-10
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 15 239 1.0E-10
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 3 237 1.0E-10
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 18 237 2.0E-10
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 1 239 3.0E-10
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 18 237 3.0E-10
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 18 237 3.0E-10
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 18 237 4.0E-10
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 19 243 8.0E-10
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 18 237 8.0E-10
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 15 239 2.0E-09
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 19 239 2.0E-09
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 1 236 3.0E-09
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 1 241 4.0E-09
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 18 237 5.0E-09
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 3 239 6.0E-09
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 18 237 6.0E-09
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 18 237 1.0E-08
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 1 263 1.0E-08
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 1 239 1.0E-08
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 1 241 2.0E-08
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 1 239 3.0E-08
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 3 239 5.0E-08
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 1 228 1.0E-07
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 1 241 1.0E-07
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 1 228 8.0E-07
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 1 228 1.0E-06
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 1 239 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 272 294 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5109
MGLGLSSNVAARRPYPALVDNMVAQGIIDTPVFSLHLDHVDAKAGSILFGGLDLQKFLAKLVSLPLLPDDDSSTI
RSYAIRLRRLDINGVALTALHARAILDSGSTITLLPYTHTRHIHAHYGVRSLPNLNTPLVDCARRTDAPSAALTF
HFDAGASIRVPINDMIMDIIPPDMQSLLRQTSAPTPLPSSWRAICVFGIASASDYAVSTPSFAILGDSFLRSAYI
VYDLANRQLGLAQANPRSRGSNIIPLSANSTTLSNYMGVDESKAVRAPNFGLGILISALAIVALVTTFLLI*
Coding >OphauB2|5109
ATGGGCCTCGGCCTGTCCTCCAACGTGGCCGCCCGCAGGCCCTATCCCGCCCTGGTCGACAACATGGTTGCCCAG
GGCATCATTGACACGCCCGTCTTTAGCCTCCATCTGGATCATGTCGACGCCAAGGCTGGCTCCATTCTCTTTGGC
GGCCTCGATTTGCAAAAGTTTCTTGCAAAACTCGTCTCCCTGCCCTTGCTGCCCGACGACGACTCGTCCACCATT
CGCTCCTATGCCATTAGGCTGCGCCGTCTAGACATCAACGGCGTCGCTCTCACTGCCCTCCATGCCCGCGCCATC
CTCGACTCTGGCTCCACCATTACTCTCCTCCCATATACCCACACCCGCCACATCCATGCCCACTATGGCGTCCGC
TCCCTCCCCAATCTCAATACGCCCCTTGTCGACTGCGCCCGCCGCACCGACGCTCCTTCGGCCGCCCTGACCTTT
CACTTTGACGCCGGCGCCTCAATCCGCGTCCCCATCAACGACATGATTATGGATATTATCCCTCCCGATATGCAG
TCCCTCTTGCGCCAAACTTCGGCCCCCACGCCTCTGCCATCCTCTTGGCGTGCCATCTGCGTCTTTGGAATCGCC
TCTGCCTCCGACTATGCCGTCTCTACTCCTAGCTTTGCCATCCTTGGCGACTCCTTTCTCCGCTCAGCCTACATT
GTCTACGACCTTGCCAATCGCCAGCTCGGTCTTGCCCAGGCAAATCCGCGAAGCCGCGGCTCCAACATTATTCCT
CTATCTGCAAACTCGACAACACTGTCCAACTACATGGGCGTCGACGAAAGCAAAGCCGTGCGTGCTCCCAACTTT
GGGCTGGGTATCCTCATCAGCGCCCTCGCCATTGTGGCCCTCGTCACCACCTTTTTGCTCATATAA
Transcript >OphauB2|5109
ATGGGCCTCGGCCTGTCCTCCAACGTGGCCGCCCGCAGGCCCTATCCCGCCCTGGTCGACAACATGGTTGCCCAG
GGCATCATTGACACGCCCGTCTTTAGCCTCCATCTGGATCATGTCGACGCCAAGGCTGGCTCCATTCTCTTTGGC
GGCCTCGATTTGCAAAAGTTTCTTGCAAAACTCGTCTCCCTGCCCTTGCTGCCCGACGACGACTCGTCCACCATT
CGCTCCTATGCCATTAGGCTGCGCCGTCTAGACATCAACGGCGTCGCTCTCACTGCCCTCCATGCCCGCGCCATC
CTCGACTCTGGCTCCACCATTACTCTCCTCCCATATACCCACACCCGCCACATCCATGCCCACTATGGCGTCCGC
TCCCTCCCCAATCTCAATACGCCCCTTGTCGACTGCGCCCGCCGCACCGACGCTCCTTCGGCCGCCCTGACCTTT
CACTTTGACGCCGGCGCCTCAATCCGCGTCCCCATCAACGACATGATTATGGATATTATCCCTCCCGATATGCAG
TCCCTCTTGCGCCAAACTTCGGCCCCCACGCCTCTGCCATCCTCTTGGCGTGCCATCTGCGTCTTTGGAATCGCC
TCTGCCTCCGACTATGCCGTCTCTACTCCTAGCTTTGCCATCCTTGGCGACTCCTTTCTCCGCTCAGCCTACATT
GTCTACGACCTTGCCAATCGCCAGCTCGGTCTTGCCCAGGCAAATCCGCGAAGCCGCGGCTCCAACATTATTCCT
CTATCTGCAAACTCGACAACACTGTCCAACTACATGGGCGTCGACGAAAGCAAAGCCGTGCGTGCTCCCAACTTT
GGGCTGGGTATCCTCATCAGCGCCCTCGCCATTGTGGCCCTCGTCACCACCTTTTTGCTCATATAA
Gene >OphauB2|5109
ATGGGCCTCGGCCTGTCCTCCAACGTGGCCGCCCGCAGGCCCTATCCCGCCCTGGTCGACAACATGGTTGCCCAG
GGCATCATTGACACGCCCGTCTTTAGCCTCCATCTGGATCATGTCGACGCCAAGGCTGGCTCCATTCTCTTTGGC
GGCCTCGATTTGCAAAAGTTTCTTGCAAAACTCGTCTCCCTGCCCTTGCTGCCCGACGACGACTCGTCCACCATT
CGCTCCTATGCCATTAGGCTGCGCCGTCTAGACATCAACGGCGTCGCTCTCACTGCCCTCCATGCCCGCGCCATC
CTCGACTCTGGCTCCACCATTACTCTCCTCCCATATACCCACACCCGCCACATCCATGCCCACTATGGCGTCCGC
TCCCTCCCCAATCTCAATACGCCCCTTGTCGACTGCGCCCGCCGCACCGACGCTCCTTCGGCCGCCCTGACCTTT
CACTTTGACGCCGGCGCCTCAATCCGCGTCCCCATCAACGACATGATTATGGATATTATCCCTCCCGATATGCAG
TCCCTCTTGCGCCAAACTTCGGCCCCCACGCCTCTGCCATCCTCTTGGCGTGCCATCTGCGTCTTTGGAATCGCC
TCTGCCTCCGACTATGCCGTCTCTACTCCTAGCTTTGCCATCCTTGGCGACTCCTTTCTCCGCTCAGCCTACATT
GTCTACGACCTTGCCAATCGCCAGCTCGGTCTTGCCCAGGCAAATCCGCGAAGCCGCGGCTCCAACATTATTCCT
CTATCTGCAAACTCGACAACACTGTCCAACTACATGGGCGTCGACGGTAACTACACTTGTTTTCTTTCCTCTTGT
GCTCTCTCTCTTTTTTTTTCCTTTCTTGAATTTCTTCAGCGCACCCTCTCGACTAATCCCTCTCTCTGTAAAAGA
AAGCAAAGCCGTGCGTGCTCCCAACTTTGGGCTGGGTATCCTCATCAGCGCCCTCGCCATTGTGGCCCTCGTCAC
CACCTTTTTGCTCATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail