Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5101
Gene name
LocationContig_38:26425..29481
Strand+
Gene length (bp)3056
Transcript length (bp)2631
Coding sequence length (bp)2631
Protein length (aa) 877

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02985 HEAT HEAT repeat 5.3E-04 414 443
PF13513 HEAT_EZ HEAT-like repeat 7.7E-09 384 438
PF03810 IBN_N Importin-beta N-terminal domain 6.8E-10 24 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13864|IMB1_SCHPO Importin subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap95 PE=3 SV=1 8 865 0.0E+00
sp|Q06142|IMB1_YEAST Importin subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP95 PE=1 SV=1 1 867 0.0E+00
sp|P52297|IMB_XENLA Importin subunit beta OS=Xenopus laevis GN=kpnb1 PE=1 SV=3 5 864 4.0E-178
sp|P70168|IMB1_MOUSE Importin subunit beta-1 OS=Mus musculus GN=Kpnb1 PE=1 SV=2 5 864 7.0E-176
sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens GN=KPNB1 PE=1 SV=2 5 864 1.0E-175
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13864|IMB1_SCHPO Importin subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap95 PE=3 SV=1 8 865 0.0E+00
sp|Q06142|IMB1_YEAST Importin subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP95 PE=1 SV=1 1 867 0.0E+00
sp|P52297|IMB_XENLA Importin subunit beta OS=Xenopus laevis GN=kpnb1 PE=1 SV=3 5 864 4.0E-178
sp|P70168|IMB1_MOUSE Importin subunit beta-1 OS=Mus musculus GN=Kpnb1 PE=1 SV=2 5 864 7.0E-176
sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens GN=KPNB1 PE=1 SV=2 5 864 1.0E-175
sp|P52296|IMB1_RAT Importin subunit beta-1 OS=Rattus norvegicus GN=Kpnb1 PE=1 SV=1 5 864 9.0E-172
sp|O18388|IMB_DROME Importin subunit beta OS=Drosophila melanogaster GN=Fs(2)Ket PE=2 SV=2 9 864 8.0E-167
sp|Q9FJD4|IMB1_ARATH Importin subunit beta-1 OS=Arabidopsis thaliana GN=KPNB1 PE=1 SV=1 5 866 3.0E-160
sp|Q8BFY9|TNPO1_MOUSE Transportin-1 OS=Mus musculus GN=Tnpo1 PE=1 SV=2 13 489 2.0E-11
sp|Q3SYU7|TNPO1_BOVIN Transportin-1 OS=Bos taurus GN=TNPO1 PE=1 SV=2 13 489 3.0E-11
sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens GN=TNPO1 PE=1 SV=2 13 489 3.0E-11
sp|Q8H0U4|TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana GN=TRN1 PE=1 SV=1 4 500 2.0E-07
sp|O14787|TNPO2_HUMAN Transportin-2 OS=Homo sapiens GN=TNPO2 PE=1 SV=3 12 489 1.0E-06
sp|P40069|IMB4_YEAST Importin subunit beta-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP123 PE=1 SV=1 77 458 2.0E-06
sp|O14089|IMB2_SCHPO Importin subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap104 PE=3 SV=1 345 735 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0031267 small GTPase binding Yes
GO:0006886 intracellular protein transport Yes
GO:0033036 macromolecule localization No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0071702 organic substance transport No
GO:0003674 molecular_function No
GO:0015031 protein transport No
GO:0019899 enzyme binding No
GO:0051179 localization No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0051020 GTPase binding No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5101
MSSSEISQVLANSLSPDANLRNAAEQQLSQATESNFPLYLATLVQELANDDVETPIRVAAGLALKNAFTARDHGR
HQELQAKWLQQTDEETKNRVKQLTLQTLASSSAQVGNAVAQVISSIAAIELPRNQWPDLMTFLVKNVSDGADHQK
QASLTTIGYICESQDQELRLALVAQSNAILTAVVQGARKEETNNEVRLAAITALGDSLEFVGNNFKHEGERNYIM
QVVCEATQADDARVQQGAFGCLNRIMALYYDNMRFYMEKALFGLTILGMKSSDEDVAKLAIEFWCTVCEEELSIE
DDNSQVESADQMRPFFNFARVAASEVVPALLQLLTKQDEDASDDEYNLSRAAYQCLQLYSQAVCASIIAPVLQFV
EQNLRSDNWHNRDAAVSAFGAIMEGPEEKVLEPIVKQALPVLITMMQDQSLQVRDSTAYALGRVTEACSDAIDPE
QQLPSLIESLFKGLHDNAKMAPSCCWALMNLAERFAGEIGAATNPMTRHFNDAVRSLLELTVRQEIDTSVRTAAY
EVLNVFVQNSASQSLSPVASLSEVIIKRLEETVPLQSQVVSVEDKIALEEMQNSLCTVLQAIILRLDGEIAPQGD
RIMHVLLQLLSIVGGKSSVPEAVFATISGLSTSLEAGFLKYMDAFAPFLYNALANQEEPSLCSMAIGLVSDITRS
LGDKSQPYCDSFMNYLLNDLRSPTLANQFKPAILQCFGDIAGAIGGHFETYLSVVAAVLVQASGVSATPDGPYEM
YDYVVSLREGIMDAWGGIIGAMKLDGKTQVLIQYVGNIFELLKQIANDLNRSETLMRACMGVIGDLAEAFPNGEL
VDAFRENYVTVMIKETKTNRDFQPRTIETARWAREQVKRQLGGVQTVMTQA*
Coding >OphauB2|5101
ATGTCGAGCTCAGAAATTAGCCAAGTGCTCGCCAATTCTCTGTCTCCGGACGCGAACTTGCGAAATGCTGCCGAG
CAGCAGTTAAGCCAGGCAACCGAAAGCAATTTTCCCCTCTATCTTGCCACTCTTGTTCAGGAGCTGGCCAACGAT
GACGTAGAGACTCCTATTCGAGTTGCTGCCGGTCTTGCTCTCAAAAACGCCTTCACCGCACGCGACCACGGTCGC
CACCAAGAGCTGCAGGCAAAATGGCTGCAACAAACCGACGAAGAGACCAAGAATCGTGTCAAGCAACTGACGTTG
CAGACGCTCGCATCTTCAAGTGCCCAGGTTGGCAACGCTGTCGCCCAAGTCATCTCGTCGATTGCTGCCATCGAG
CTGCCTCGAAATCAATGGCCAGACCTTATGACTTTTCTTGTCAAGAATGTCAGCGACGGCGCCGATCACCAGAAG
CAGGCATCCTTGACCACTATAGGCTATATCTGCGAGAGTCAAGATCAGGAGCTGCGCTTGGCTCTCGTGGCCCAG
TCCAATGCAATCTTGACTGCCGTTGTACAAGGTGCACGCAAAGAGGAAACCAATAATGAGGTGCGACTGGCTGCA
ATCACCGCGCTTGGTGATTCTTTAGAGTTTGTTGGCAACAACTTCAAGCACGAGGGCGAACGCAACTACATCATG
CAGGTGGTTTGCGAGGCCACGCAGGCCGACGACGCACGCGTCCAACAGGGTGCCTTTGGCTGCCTTAACCGCATA
ATGGCCCTCTACTATGACAATATGCGCTTCTACATGGAAAAAGCACTCTTTGGGCTTACCATTCTCGGCATGAAG
TCCTCTGATGAGGACGTTGCCAAGCTGGCTATTGAGTTTTGGTGCACCGTTTGTGAAGAGGAACTGTCCATTGAG
GACGACAACTCACAGGTTGAGAGTGCCGATCAGATGCGACCCTTCTTTAACTTCGCCAGGGTTGCAGCCAGCGAA
GTCGTGCCGGCACTACTTCAACTTTTGACAAAGCAAGACGAGGATGCATCCGACGACGAATACAACCTTTCCCGA
GCAGCCTATCAATGTCTCCAGCTCTATTCGCAGGCTGTATGTGCTAGCATAATTGCTCCAGTACTGCAGTTTGTC
GAGCAGAATCTGCGCTCTGATAACTGGCACAACCGGGATGCTGCCGTGTCTGCTTTTGGGGCCATCATGGAAGGC
CCTGAGGAGAAGGTGCTGGAGCCCATCGTTAAGCAGGCCCTCCCCGTCCTTATAACAATGATGCAGGACCAGTCT
CTACAGGTGCGCGACTCTACAGCGTATGCTCTTGGCCGTGTCACCGAGGCCTGCTCCGACGCCATTGATCCCGAA
CAGCAACTTCCCAGCCTGATTGAATCTCTGTTCAAGGGTCTGCATGATAATGCCAAGATGGCTCCTTCATGCTGC
TGGGCTCTGATGAATCTGGCGGAGCGTTTTGCCGGAGAGATTGGAGCTGCCACAAATCCCATGACGCGGCACTTC
AACGACGCTGTCCGCTCGCTACTCGAGTTGACAGTTCGGCAAGAGATTGATACTTCTGTGCGCACCGCTGCTTAC
GAGGTGCTCAACGTCTTTGTCCAGAATTCGGCTTCGCAAAGTTTGTCGCCTGTTGCATCGCTCTCCGAGGTTATC
ATCAAGAGACTTGAGGAAACGGTGCCACTGCAGTCCCAGGTGGTGAGCGTCGAGGACAAGATTGCCCTGGAAGAG
ATGCAAAACAGCCTTTGTACCGTGTTGCAGGCCATTATTTTGCGTCTTGATGGCGAGATTGCTCCTCAGGGCGAC
CGCATTATGCATGTTTTGTTGCAACTTCTAAGCATCGTCGGCGGCAAGTCGAGCGTTCCTGAAGCCGTCTTTGCC
ACCATCAGTGGCCTGTCCACTTCGCTTGAAGCCGGCTTCCTCAAGTATATGGACGCCTTTGCCCCATTTCTTTAC
AATGCTCTGGCCAACCAAGAGGAGCCTAGTCTCTGTTCCATGGCTATTGGCCTAGTGAGCGACATTACGAGGTCC
TTGGGTGACAAATCTCAGCCGTACTGCGACAGTTTTATGAATTATCTCCTCAACGACTTGAGGAGCCCTACTCTG
GCCAACCAGTTCAAGCCTGCAATTCTGCAATGCTTTGGCGACATTGCTGGTGCAATTGGTGGGCACTTTGAAACG
TACCTGTCTGTTGTGGCTGCAGTCTTGGTACAGGCTTCTGGTGTATCTGCGACACCAGACGGCCCGTATGAGATG
TATGACTATGTCGTTTCTCTTCGCGAGGGAATCATGGATGCTTGGGGCGGTATAATCGGAGCCATGAAGCTGGAT
GGCAAGACCCAAGTTCTCATTCAATACGTGGGCAACATCTTCGAGTTGCTCAAGCAGATTGCAAACGACTTGAAC
CGCAGCGAAACCTTGATGCGCGCGTGCATGGGTGTCATTGGTGACCTTGCCGAGGCGTTTCCCAATGGCGAGCTT
GTTGACGCGTTTCGAGAGAACTACGTGACAGTCATGATCAAGGAAACAAAGACAAACCGCGACTTCCAGCCGCGG
ACTATTGAGACGGCTCGTTGGGCGCGTGAACAGGTCAAGCGCCAACTTGGCGGCGTCCAGACTGTCATGACACAG
GCTTGA
Transcript >OphauB2|5101
ATGTCGAGCTCAGAAATTAGCCAAGTGCTCGCCAATTCTCTGTCTCCGGACGCGAACTTGCGAAATGCTGCCGAG
CAGCAGTTAAGCCAGGCAACCGAAAGCAATTTTCCCCTCTATCTTGCCACTCTTGTTCAGGAGCTGGCCAACGAT
GACGTAGAGACTCCTATTCGAGTTGCTGCCGGTCTTGCTCTCAAAAACGCCTTCACCGCACGCGACCACGGTCGC
CACCAAGAGCTGCAGGCAAAATGGCTGCAACAAACCGACGAAGAGACCAAGAATCGTGTCAAGCAACTGACGTTG
CAGACGCTCGCATCTTCAAGTGCCCAGGTTGGCAACGCTGTCGCCCAAGTCATCTCGTCGATTGCTGCCATCGAG
CTGCCTCGAAATCAATGGCCAGACCTTATGACTTTTCTTGTCAAGAATGTCAGCGACGGCGCCGATCACCAGAAG
CAGGCATCCTTGACCACTATAGGCTATATCTGCGAGAGTCAAGATCAGGAGCTGCGCTTGGCTCTCGTGGCCCAG
TCCAATGCAATCTTGACTGCCGTTGTACAAGGTGCACGCAAAGAGGAAACCAATAATGAGGTGCGACTGGCTGCA
ATCACCGCGCTTGGTGATTCTTTAGAGTTTGTTGGCAACAACTTCAAGCACGAGGGCGAACGCAACTACATCATG
CAGGTGGTTTGCGAGGCCACGCAGGCCGACGACGCACGCGTCCAACAGGGTGCCTTTGGCTGCCTTAACCGCATA
ATGGCCCTCTACTATGACAATATGCGCTTCTACATGGAAAAAGCACTCTTTGGGCTTACCATTCTCGGCATGAAG
TCCTCTGATGAGGACGTTGCCAAGCTGGCTATTGAGTTTTGGTGCACCGTTTGTGAAGAGGAACTGTCCATTGAG
GACGACAACTCACAGGTTGAGAGTGCCGATCAGATGCGACCCTTCTTTAACTTCGCCAGGGTTGCAGCCAGCGAA
GTCGTGCCGGCACTACTTCAACTTTTGACAAAGCAAGACGAGGATGCATCCGACGACGAATACAACCTTTCCCGA
GCAGCCTATCAATGTCTCCAGCTCTATTCGCAGGCTGTATGTGCTAGCATAATTGCTCCAGTACTGCAGTTTGTC
GAGCAGAATCTGCGCTCTGATAACTGGCACAACCGGGATGCTGCCGTGTCTGCTTTTGGGGCCATCATGGAAGGC
CCTGAGGAGAAGGTGCTGGAGCCCATCGTTAAGCAGGCCCTCCCCGTCCTTATAACAATGATGCAGGACCAGTCT
CTACAGGTGCGCGACTCTACAGCGTATGCTCTTGGCCGTGTCACCGAGGCCTGCTCCGACGCCATTGATCCCGAA
CAGCAACTTCCCAGCCTGATTGAATCTCTGTTCAAGGGTCTGCATGATAATGCCAAGATGGCTCCTTCATGCTGC
TGGGCTCTGATGAATCTGGCGGAGCGTTTTGCCGGAGAGATTGGAGCTGCCACAAATCCCATGACGCGGCACTTC
AACGACGCTGTCCGCTCGCTACTCGAGTTGACAGTTCGGCAAGAGATTGATACTTCTGTGCGCACCGCTGCTTAC
GAGGTGCTCAACGTCTTTGTCCAGAATTCGGCTTCGCAAAGTTTGTCGCCTGTTGCATCGCTCTCCGAGGTTATC
ATCAAGAGACTTGAGGAAACGGTGCCACTGCAGTCCCAGGTGGTGAGCGTCGAGGACAAGATTGCCCTGGAAGAG
ATGCAAAACAGCCTTTGTACCGTGTTGCAGGCCATTATTTTGCGTCTTGATGGCGAGATTGCTCCTCAGGGCGAC
CGCATTATGCATGTTTTGTTGCAACTTCTAAGCATCGTCGGCGGCAAGTCGAGCGTTCCTGAAGCCGTCTTTGCC
ACCATCAGTGGCCTGTCCACTTCGCTTGAAGCCGGCTTCCTCAAGTATATGGACGCCTTTGCCCCATTTCTTTAC
AATGCTCTGGCCAACCAAGAGGAGCCTAGTCTCTGTTCCATGGCTATTGGCCTAGTGAGCGACATTACGAGGTCC
TTGGGTGACAAATCTCAGCCGTACTGCGACAGTTTTATGAATTATCTCCTCAACGACTTGAGGAGCCCTACTCTG
GCCAACCAGTTCAAGCCTGCAATTCTGCAATGCTTTGGCGACATTGCTGGTGCAATTGGTGGGCACTTTGAAACG
TACCTGTCTGTTGTGGCTGCAGTCTTGGTACAGGCTTCTGGTGTATCTGCGACACCAGACGGCCCGTATGAGATG
TATGACTATGTCGTTTCTCTTCGCGAGGGAATCATGGATGCTTGGGGCGGTATAATCGGAGCCATGAAGCTGGAT
GGCAAGACCCAAGTTCTCATTCAATACGTGGGCAACATCTTCGAGTTGCTCAAGCAGATTGCAAACGACTTGAAC
CGCAGCGAAACCTTGATGCGCGCGTGCATGGGTGTCATTGGTGACCTTGCCGAGGCGTTTCCCAATGGCGAGCTT
GTTGACGCGTTTCGAGAGAACTACGTGACAGTCATGATCAAGGAAACAAAGACAAACCGCGACTTCCAGCCGCGG
ACTATTGAGACGGCTCGTTGGGCGCGTGAACAGGTCAAGCGCCAACTTGGCGGCGTCCAGACTGTCATGACACAG
GCTTGA
Gene >OphauB2|5101
ATGTCGAGCTCAGAAATTAGCCAAGTGCTCGCCAATTCTCTGTCTCCGGGTGAGTCTTGGCCATCCACGGCTCTG
TCCGCTGTAGCTGTGGCGTTTGAAGTCTCTTCAAACCCCTCTCTTTTCTCCAAGGCCAAATGAAGCGGCCATGAC
GCGCGTGCAGCTGCCGACAATGTTCACGCCATGAAGCAAGTTTGTCTTGGCTGACCCTTGTCTACTGTGACAGAC
GCGAACTTGCGAAATGCTGCCGAGCAGCAGTTAAGCCAGGCAACCGAAAGCAATTTTGTACGCCTGCCTGGTCTT
CCCTAGCCTCTACGTCCATGTGCCGCTGACTCGTGGCGCCCTTTGATTCAACTTGCAGCCCCTCTATCTTGCCAC
TCTTGTTCAGGAGCTGGCCAACGATGACGTAGAGACTCCTATTCGAGTTGCTGCCGGTCTTGCTCTCAAAAACGC
CTTCACCGCACGCGACCACGGTCGCCACCAAGAGCTGCAGGCAAAATGGCTGCAACAAACCGACGAAGAGACCAA
GAATCGTGTCAAGCAACTGACGTTGCAGACGCTCGCATCTTCAAGTGCCCAGGTTGGCAACGCTGTCGCCCAAGT
CATCTCGTCGATTGCTGCCATCGAGCTGCCTCGAAATCAATGGCCAGACCTTATGACTTTTCTTGTCAAGAATGT
CAGCGACGGCGCCGATCACCAGAAGCAGGCATCCTTGACCACTATAGGCTATATCTGCGAGAGTCAAGATCAGGA
GCTGCGCTTGGCTCTCGTGGCCCAGTCCAATGCAATCTTGACTGCCGTTGTACAAGGTGCACGCAAAGAGGAAAC
CAATAATGAGGTGCGACTGGCTGCAATCACCGCGCTTGGTGATTCTTTAGAGTTTGTTGGCAACAACTTCAAGCA
CGAGGGCGAACGCAACTACATCATGCAGGTGGTTTGCGAGGCCACGCAGGCCGACGACGCACGCGTCCAACAGGG
TGCCTTTGGCTGCCTTAACCGCATAATGGCCCTCTACTATGACAATATGCGCTTCTACATGGAAAAAGCACTCTT
TGGGCTTACCATTCTCGGCATGAAGTCCTCTGATGAGGACGTTGCCAAGCTGGCTATTGAGTTTTGGTGCACCGT
TTGTGAAGAGGAACTGTCCATTGAGGACGACAACTCACAGGTTGAGAGTGCCGATCAGATGCGACCCTTCTTTAA
CTTCGCCAGGGTTGCAGCCAGCGAAGTCGTGCCGGCACTACTTCAACTTTTGACAAAGCAAGACGAGGATGCATC
CGACGACGAATACAACCTTTCCCGAGCAGCCTATCAATGTCTCCAGCTCTATTCGCAGGCTGTATGTGCTAGCAT
AATTGCTCCAGTACTGCAGTTTGTCGAGCAGAATCTGCGCTCTGATAACTGGCACAACCGGGATGCTGCCGTGTC
TGCTTTTGGGGCCATCATGGAAGGCCCTGAGGAGAAGGTGCTGGAGCCCATCGTTAAGCAGGCCCTCCCCGTCCT
TATAACAATGATGCAGGACCAGTCTCTACAGGTGCGCGACTCTACAGCGTATGCTCTTGGCCGTGTCACCGAGGC
CTGCTCCGACGCCATTGATCCCGAACAGCAACTTCCCAGCCTGATTGAATCTCTGTTCAAGGGTCTGCATGATAA
TGCCAAGATGGCTCCTTCATGCTGCTGGGCTCTGATGAATCTGGCGGAGCGTTTTGCCGGAGAGATTGGAGCTGC
CACAAATCCCATGACGCGGCACTTCAACGACGCTGTCCGCTCGCTACTCGAGTTGACAGTTCGGCAAGAGATTGA
TACTTCTGTGCGCACCGCTGCTTACGAGGTGCTCAACGTCTTTGTCCAGAATTCGGCTTCGCAAAGTTTGTCGCC
TGTTGCATCGCTCTCCGAGGTTATCATCAAGAGACTTGAGGAAACGGTGCCACTGCAGTCCCAGGTGGTGAGCGT
CGAGGACAAGATTGCCCTGGAAGAGATGCAAAACAGCCTTTGTACCGTGTTGCAGGCCATTATTTTGCGTCTTGA
TGGCGAGATTGCTCCTCAGGGCGACCGCATTATGCATGTTTTGTTGCAACTTCTAAGCATCGTCGGCGGCAAGTC
GAGCGTTCCTGAAGCCGTCTTTGCCACCATCAGTGGCCTGTCCACTTCGCTTGAAGCCGGCTTCCTCAAGTATAT
GGACGCCTTTGCCCCATTTCTTTACAATGCTCTGGCCAACCAAGAGGAGCCTAGTCTCTGTTCCATGGCTATTGG
CCTAGTGAGCGACATTACGAGGTCCTTGGGTGACAAATCTCAGCCGTACTGCGACAGTTTTATGAATTATCTCCT
CAACGACTTGAGGGTCAGTCTTGTGTCCCTCTGGCAGAGCTTTGGCGTTTGTGTCTTGCTAACGAGGATTCCAGA
GCCCTACTCTGGCCAACCAGTTCAAGCCTGCAATTCTGCAATGCTTTGGCGACATTGCTGGTGCAATTGGTGGGC
ACTTTGAAACGTACCTGTCTGTTGTGGCTGCAGTCTTGGTACAGGCTTCTGGTGTATCTGCGACACCAGACGGCC
CGTATGAGATGTATGACTATGTCGTTTCTCTTCGCGAGGGAATCATGGATGCTTGGGGCGGTATAATCGGAGCCA
TGAAGCTGGATGGCAAGAGTAGGTTGGGACTCCTCCCTCGACGCGCTGCTGGACTAACCTTTTTGCTGCAGCCCA
AGTTCTCATTCAATACGTGGGCAACATCTTCGAGTTGCTCAAGCAGATTGCAAACGACTTGAACCGCAGCGAAAC
CTTGATGCGCGCGTGCATGGGTGTCATTGGGTAGGTGGTAGAAATGGTTTGCCGTGACGGCCGACAGCTGCTGAC
GGAAGCATCTTGACAGTGACCTTGCCGAGGCGTTTCCCAATGGCGAGCTTGTTGACGCGTTTCGAGAGAACTACG
TGACAGTCATGATCAAGGAAACAAAGACAAACCGCGACTTCCAGCCGCGGACTATTGAGACGGCTCGTTGGGCGC
GTGAACAGGTCAAGCGCCAACTTGGCGGCGTCCAGACTGTCATGACACAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail