Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|51
Gene name
LocationContig_1:116576..118630
Strand-
Gene length (bp)2054
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00326 Peptidase_S9 Prolyl oligopeptidase family 2.7E-34 425 626
PF01738 DLH Dienelactone hydrolase family 3.7E-05 481 618

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|V5YMB3|DAPB3_PSEMX Dipeptidyl aminopeptidase BIII OS=Pseudoxanthomonas mexicana GN=dapb3 PE=1 SV=1 281 635 8.0E-23
sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 352 616 2.0E-19
sp|P34422|DPF6_CAEEL Dipeptidyl peptidase family member 6 OS=Caenorhabditis elegans GN=dpf-6 PE=3 SV=2 407 619 4.0E-17
sp|Q6F3I7|DAP4_PSEMX Dipeptidyl aminopeptidase 4 OS=Pseudoxanthomonas mexicana GN=dap4 PE=1 SV=1 234 614 6.0E-15
sp|P80227|ACPH_BOVIN Acylamino-acid-releasing enzyme OS=Bos taurus GN=APEH PE=1 SV=2 382 616 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|V5YMB3|DAPB3_PSEMX Dipeptidyl aminopeptidase BIII OS=Pseudoxanthomonas mexicana GN=dapb3 PE=1 SV=1 281 635 8.0E-23
sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 352 616 2.0E-19
sp|P34422|DPF6_CAEEL Dipeptidyl peptidase family member 6 OS=Caenorhabditis elegans GN=dpf-6 PE=3 SV=2 407 619 4.0E-17
sp|Q6F3I7|DAP4_PSEMX Dipeptidyl aminopeptidase 4 OS=Pseudoxanthomonas mexicana GN=dap4 PE=1 SV=1 234 614 6.0E-15
sp|P80227|ACPH_BOVIN Acylamino-acid-releasing enzyme OS=Bos taurus GN=APEH PE=1 SV=2 382 616 2.0E-13
sp|P19205|ACPH_PIG Acylamino-acid-releasing enzyme OS=Sus scrofa GN=APEH PE=1 SV=2 406 624 1.0E-12
sp|Q95WU5|DPP_GIAIN Dipeptidyl-peptidase 4 OS=Giardia intestinalis GN=DPP PE=1 SV=1 367 623 2.0E-12
sp|P13676|ACPH_RAT Acylamino-acid-releasing enzyme OS=Rattus norvegicus GN=Apeh PE=1 SV=1 387 624 2.0E-12
sp|Q8R146|APEH_MOUSE Acylamino-acid-releasing enzyme OS=Mus musculus GN=Apeh PE=1 SV=3 406 624 2.0E-12
sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens GN=APEH PE=1 SV=4 339 624 3.0E-12
sp|Q7JKY3|DPF1_CAEEL Dipeptidyl peptidase family member 1 OS=Caenorhabditis elegans GN=dpf-1 PE=1 SV=1 406 619 1.0E-08
sp|Q9YBQ2|APEH_AERPE Acylamino-acid-releasing enzyme OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_1547.1 PE=1 SV=1 406 615 2.0E-08
sp|Q7MUW6|PTP_PORGI Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ptpA PE=1 SV=1 352 623 1.0E-06
sp|B2RJX3|PTP_PORG3 Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ptpA PE=3 SV=1 352 623 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0016787 hydrolase activity Yes
GO:0006508 proteolysis Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|51
MVRKTVAPHGKWPSPISVDSVVSMGRLSTPRVSRSGRIFFQEAGLDGRSRLLEVTRSGVKEVLPAPYSASNRVYE
YGGALFDVLPDSRLVLSNWDDSVCMVEPDAQRVSVLVPSSSSLRYASFSANATSPWILAIEEEHAGQEAAGVRNR
IVALNAETAQVKRVVEGADFYYQPRFSSHGARLCWLEWNRPDLPFDAAKLYVAEWKADGGEVSQKRLVAGGSGQS
VAEPSWGPDGTLFFAMEQGPYRQLYKLAPGSTSPAAIPLEGLEDHSIQPLSKDTLVAAPYTNGVRHMIAIDLQTH
KWHRLADTETICQLDDDATARLNDTSLVVVGSGTTSSPALWQIDVHKPATIKALHKATEHQFPPSLLSRPEQIAL
QAKTSRGQTTHGFLWMPHNPDYTGAPDELPPLIITVHGGPTSVMGCGLNLRTQYFTTRGYAVLGINHHGSAGHGR
DYRNSLFGQWGLVDADDTGQCAEQLASTGRVRKTGIGITGLSAGGYNTLQSIVRHGSSFAGALCVSGVCELSKFS
ATTHKLEMDYTPALALERPESVDEEHRERVYRERSPLYHTHKIKTPLLMLHGRDDTVVAEEQPRMLTEKLKAQGA
DVELVLVEGDSHKLDKPTSVRLWLELEEKMWSETLL*
Coding >OphauB2|51
ATGGTGCGCAAAACTGTGGCGCCTCATGGCAAATGGCCATCGCCTATAAGCGTGGATTCCGTGGTGAGCATGGGC
CGCTTGTCGACTCCTCGCGTCTCGCGCTCTGGACGCATCTTTTTCCAGGAGGCGGGGCTTGACGGCAGGAGCAGG
TTGCTCGAGGTTACGAGGAGCGGCGTCAAGGAGGTGCTGCCGGCTCCGTACAGCGCCAGCAACAGAGTCTACGAA
TACGGCGGAGCGCTATTTGACGTGCTGCCGGATAGCCGCCTTGTGCTGTCGAATTGGGACGATTCGGTGTGCATG
GTGGAGCCTGACGCGCAGCGAGTCAGCGTACTTGTGCCGTCGAGCTCGTCGCTGCGCTATGCCAGCTTCAGCGCC
AATGCCACTTCGCCCTGGATCCTTGCCATTGAAGAAGAGCATGCCGGTCAGGAGGCGGCTGGGGTGCGCAACCGC
ATCGTGGCCCTCAATGCCGAGACGGCCCAGGTGAAGCGGGTGGTGGAGGGAGCCGACTTTTACTACCAGCCGCGC
TTCAGCAGCCATGGCGCGCGCCTCTGCTGGCTCGAGTGGAATCGTCCCGACCTGCCCTTTGATGCGGCCAAGCTG
TACGTTGCCGAGTGGAAGGCAGACGGGGGCGAGGTGAGCCAGAAGCGTCTGGTGGCGGGCGGCAGCGGCCAGAGC
GTCGCCGAGCCAAGCTGGGGCCCCGACGGCACTCTCTTCTTTGCCATGGAGCAGGGACCCTATCGCCAGCTGTAC
AAGCTTGCACCGGGAAGCACGTCGCCCGCTGCTATCCCGCTCGAGGGCCTGGAGGATCACTCCATTCAGCCTCTG
TCCAAGGACACGCTCGTGGCAGCTCCCTACACCAATGGCGTGCGCCACATGATTGCCATTGACTTGCAGACTCAC
AAGTGGCACCGCCTGGCCGACACGGAGACAATCTGCCAGCTCGACGACGACGCCACGGCACGCCTCAACGACACA
AGTCTAGTAGTAGTGGGCAGCGGCACCACGTCGAGTCCGGCCCTGTGGCAAATCGACGTGCATAAGCCAGCCACC
ATCAAGGCTTTGCACAAGGCCACGGAGCACCAGTTCCCGCCCTCTCTCTTATCTAGGCCCGAGCAGATTGCTCTA
CAGGCCAAGACGTCACGGGGACAGACCACGCACGGCTTCCTGTGGATGCCGCACAACCCCGACTATACCGGCGCC
CCGGACGAGCTGCCCCCCCTCATCATCACGGTCCACGGCGGCCCAACAAGCGTCATGGGCTGTGGACTCAATCTC
CGAACGCAGTACTTCACAACTAGAGGATACGCCGTGCTGGGCATCAACCACCACGGCTCAGCAGGCCACGGCCGC
GACTACCGCAACTCGCTCTTTGGGCAATGGGGACTTGTCGACGCCGACGACACGGGCCAGTGCGCCGAGCAGCTG
GCGTCCACGGGGCGCGTCCGCAAAACCGGCATCGGCATCACGGGCCTCTCAGCCGGCGGCTATAACACGCTGCAG
TCCATTGTCAGGCACGGCTCCTCCTTCGCCGGCGCCCTGTGTGTCTCTGGCGTGTGCGAGCTGTCCAAGTTTAGC
GCCACCACGCACAAGCTGGAAATGGACTATACTCCAGCCCTGGCACTGGAGCGCCCTGAAAGCGTAGACGAGGAG
CATCGGGAGCGCGTCTATCGGGAGCGCAGCCCGCTCTACCACACGCACAAGATTAAGACGCCGCTGCTGATGCTG
CATGGCCGCGACGACACCGTTGTTGCCGAGGAGCAGCCGCGCATGCTGACGGAGAAGCTCAAGGCCCAGGGCGCT
GACGTTGAGCTTGTGCTGGTCGAGGGCGACAGTCACAAGCTGGACAAGCCGACAAGCGTGCGCCTATGGCTGGAG
CTGGAGGAGAAGATGTGGTCCGAGACTCTGCTGTAA
Transcript >OphauB2|51
ATGGTGCGCAAAACTGTGGCGCCTCATGGCAAATGGCCATCGCCTATAAGCGTGGATTCCGTGGTGAGCATGGGC
CGCTTGTCGACTCCTCGCGTCTCGCGCTCTGGACGCATCTTTTTCCAGGAGGCGGGGCTTGACGGCAGGAGCAGG
TTGCTCGAGGTTACGAGGAGCGGCGTCAAGGAGGTGCTGCCGGCTCCGTACAGCGCCAGCAACAGAGTCTACGAA
TACGGCGGAGCGCTATTTGACGTGCTGCCGGATAGCCGCCTTGTGCTGTCGAATTGGGACGATTCGGTGTGCATG
GTGGAGCCTGACGCGCAGCGAGTCAGCGTACTTGTGCCGTCGAGCTCGTCGCTGCGCTATGCCAGCTTCAGCGCC
AATGCCACTTCGCCCTGGATCCTTGCCATTGAAGAAGAGCATGCCGGTCAGGAGGCGGCTGGGGTGCGCAACCGC
ATCGTGGCCCTCAATGCCGAGACGGCCCAGGTGAAGCGGGTGGTGGAGGGAGCCGACTTTTACTACCAGCCGCGC
TTCAGCAGCCATGGCGCGCGCCTCTGCTGGCTCGAGTGGAATCGTCCCGACCTGCCCTTTGATGCGGCCAAGCTG
TACGTTGCCGAGTGGAAGGCAGACGGGGGCGAGGTGAGCCAGAAGCGTCTGGTGGCGGGCGGCAGCGGCCAGAGC
GTCGCCGAGCCAAGCTGGGGCCCCGACGGCACTCTCTTCTTTGCCATGGAGCAGGGACCCTATCGCCAGCTGTAC
AAGCTTGCACCGGGAAGCACGTCGCCCGCTGCTATCCCGCTCGAGGGCCTGGAGGATCACTCCATTCAGCCTCTG
TCCAAGGACACGCTCGTGGCAGCTCCCTACACCAATGGCGTGCGCCACATGATTGCCATTGACTTGCAGACTCAC
AAGTGGCACCGCCTGGCCGACACGGAGACAATCTGCCAGCTCGACGACGACGCCACGGCACGCCTCAACGACACA
AGTCTAGTAGTAGTGGGCAGCGGCACCACGTCGAGTCCGGCCCTGTGGCAAATCGACGTGCATAAGCCAGCCACC
ATCAAGGCTTTGCACAAGGCCACGGAGCACCAGTTCCCGCCCTCTCTCTTATCTAGGCCCGAGCAGATTGCTCTA
CAGGCCAAGACGTCACGGGGACAGACCACGCACGGCTTCCTGTGGATGCCGCACAACCCCGACTATACCGGCGCC
CCGGACGAGCTGCCCCCCCTCATCATCACGGTCCACGGCGGCCCAACAAGCGTCATGGGCTGTGGACTCAATCTC
CGAACGCAGTACTTCACAACTAGAGGATACGCCGTGCTGGGCATCAACCACCACGGCTCAGCAGGCCACGGCCGC
GACTACCGCAACTCGCTCTTTGGGCAATGGGGACTTGTCGACGCCGACGACACGGGCCAGTGCGCCGAGCAGCTG
GCGTCCACGGGGCGCGTCCGCAAAACCGGCATCGGCATCACGGGCCTCTCAGCCGGCGGCTATAACACGCTGCAG
TCCATTGTCAGGCACGGCTCCTCCTTCGCCGGCGCCCTGTGTGTCTCTGGCGTGTGCGAGCTGTCCAAGTTTAGC
GCCACCACGCACAAGCTGGAAATGGACTATACTCCAGCCCTGGCACTGGAGCGCCCTGAAAGCGTAGACGAGGAG
CATCGGGAGCGCGTCTATCGGGAGCGCAGCCCGCTCTACCACACGCACAAGATTAAGACGCCGCTGCTGATGCTG
CATGGCCGCGACGACACCGTTGTTGCCGAGGAGCAGCCGCGCATGCTGACGGAGAAGCTCAAGGCCCAGGGCGCT
GACGTTGAGCTTGTGCTGGTCGAGGGCGACAGTCACAAGCTGGACAAGCCGACAAGCGTGCGCCTATGGCTGGAG
CTGGAGGAGAAGATGTGGTCCGAGACTCTGCTGTAA
Gene >OphauB2|51
ATGGTGCGCAAAACTGTGGCGCCTCATGGCAAATGGCCATCGCCTATAAGCGTGGATTCCGTGGTGAGCATGGGC
CGCTTGTCGACTCCTCGCGTCTCGGTCAGTATGGCGGATGCAACTGGCGCCTGGGCAACAGCTAAAGATGCATGC
TATAGCGCTCTGGACGCATCTTTTTCCAGGAGGCGGGGCTTGACGGCAGGAGCAGGTTGCTCGAGGTTACGAGGA
GCGGCGTCAAGGAGGTGCTGCCGGCTCCGTACAGCGCCAGCAACAGAGTCTACGAATACGGCGGAGCGCTATTTG
ACGTGCTGCCGGATAGCCGCCTTGTGCTGTCGAATTGGGACGATTCGGTGTGCATGGTGGAGCCTGACGCGCAGC
GAGTCAGCGTACTTGTGCCGTCGAGCTCGTCGCTGCGCTATGCCAGCTTCAGCGCCAATGCCACTTCGCCCTGGA
TCCTTGCCATTGAAGAAGAGCATGCCGGTCAGGAGGCGGCTGGGGTGCGCAACCGCATCGTGGCCCTCAATGCCG
AGACGGCCCAGGTGAAGCGGGTGGTGGAGGGAGCCGACTTTTACTACCAGCCGCGCTTCAGCAGCCATGGCGCGC
GCCTCTGCTGGCTCGAGTGGAATCGTCCCGACCTGCCCTTTGATGCGGCCAAGCTGTACGTTGCCGAGTGGAAGG
CAGACGGGGGCGAGGTGAGCCAGAAGCGTCTGGTGGCGGGCGGCAGCGGCCAGAGCGTCGCCGAGCCAAGCTGGG
GCCCCGACGGCACTCTCTTCTTTGCCATGGAGCAGGGACCCTATCGCCAGCTGTACAAGCTTGCACCGGGAAGCA
CGTCGCCCGCTGCTATCCCGCTCGAGGGCCTGGAGGAGTGCGAGTTTGGAGACGTGGGGCTCCAAGAGGCGAGGC
GAGTGGCTGCACCCAGGCCCGGCCGACTGGCGTGCTGACAGCTTGCCAGTCACTCCATTCAGCCTCTGTCCAAGG
ACACGCTCGTGGCAGCTCCCTACACCAATGGCGTGCGCCACATGATTGCCATTGACTTGCAGACTCACAAGTGGC
ACCGCCTGGCCGACACGGAGACAATCTGCCAGCTCGACGACGACGCCACGGCACGCCTCAACGACACAAGTCTAG
TAGTAGTGGGCAGCGGCACCACGTCGAGTCCGGCCCTGTGGCAAATCGACGTGCATAAGCCAGCCACCATCAAGG
CTTTGCACAAGGCCACGGAGCACCAGTTCCCGCCCTCTCTCTTATCTAGGCCCGAGCAGATTGCTCTACAGGCCA
AGACGTCACGGGGACAGACCACGCACGGCTTCCTGTGGATGCCGCACAACCCCGACTATACCGGCGCCCCGGACG
AGCTGCCCCCCCTCATCATCACGGTCCACGGCGGCCCAACAAGCGTCATGGGCTGTGGACTCAATCTCCGAACGC
AGTACTTCACAACTAGAGGATACGCCGTGCTGGGCATCAACCACCACGGCTCAGCAGGCCACGGCCGCGACTACC
GCAACTCGCTCTTTGGGCAATGGGGACTTGTCGACGCCGACGACACGGGCCAGTGCGCCGAGCAGCTGGCGTCCA
CGGGGCGCGTCCGCAAAACCGGCATCGGCATCACGGGCCTCTCAGCCGGCGGCTATAACACGCTGCAGTCCATTG
TCAGGCACGGCTCCTCCTTCGCCGGCGCCCTGTGTGTCTCTGGCGTGTGCGAGCTGTCCAAGTTTAGCGCCACCA
CGCACAAGCTGGAAATGGACTATACTCCAGCCCTGGCACTGGAGCGCCCTGAAAGCGTAGACGAGGAGCATCGGG
AGCGCGTCTATCGGGAGCGCAGCCCGCTCTACCACACGCACAAGATTAAGACGCCGCTGCTGATGCTGCATGGCC
GCGACGACACCGTTGTTGCCGAGGAGCAGCCGCGCATGCTGACGGAGAAGCTCAAGGCCCAGGGCGCTGACGTTG
AGCTTGTGCTGGTCGAGGGCGACAGTCACAAGCTGGACAAGCCGACAAGCGTGCGCCTATGGCTGGAGCTGGAGG
AGAAGATGTGGTCCGAGACTCTGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail