Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5099
Gene name
LocationContig_38:20167..21904
Strand+
Gene length (bp)1737
Transcript length (bp)1608
Coding sequence length (bp)1608
Protein length (aa) 536

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2549
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2241
Ophiocordyceps australis map64 (Brazil) OphauB2|5099 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00782
Ophiocordyceps camponoti-rufipedis Ophun1|5258
Ophiocordyceps kimflemingae Ophio5|2610
Ophiocordyceps subramaniannii Hirsu2|3776

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5099
MSRRSVRMTEFEERDHLPHPRRSAPELDEADYRSRGARPRVATREVDEVDIRMQREDRTPAFLRDDARRSEAGPM
VLRKRDVEYYDRHNPRRSPSPVRSMRDVARRPKSVSPPSLRDEHEHSRTRFVERERIRHRSPSAPPVRFVRARSP
TPVDQERERIRTRIVEKEKERMPSPSPSPPPPPVIRGPTIEREVITHWTDVDHGVVRARPPSPAPPPRPRARERE
TDIDISLSKNRTEVDIYQSNSRPRSKSRDRRSRYYEDDVVVRRDGERLRIDEHSSSSRRRAQSAAPSTIPFDDEA
DHITSKIDSRGRMGESRGGATKDWTIVDVPPGTERVRMDGIGGASTDTTWERYSGVRRTQFIPERDGVLVPRDPS
PAPTRDRSSMAIYDREREIDVDIDRRVTRTPLLPPPPPAPAKDMWTEITKDLVMREAIEELGYEYEETREFFYIM
DYLKYEDVCELTERSESIRRARKDRVREIQWERDWRDEWERPFRRQHYRDHHDHWRSSREEWDDERIREREVMFD
SRRPTYGYLR*
Coding >OphauB2|5099
ATGTCTCGTCGCAGCGTGAGAATGACCGAATTTGAGGAGCGAGACCACTTGCCACACCCTCGCCGCTCTGCCCCC
GAGCTGGATGAAGCAGACTACCGTTCTCGTGGCGCCAGGCCCCGCGTGGCCACGCGTGAAGTGGACGAGGTGGAT
ATCCGCATGCAGAGGGAGGATCGCACGCCCGCCTTTTTAAGAGATGACGCCCGCCGTTCAGAGGCTGGGCCCATG
GTTTTGCGCAAGCGCGACGTCGAGTATTATGATCGCCACAATCCCAGAAGAAGCCCCAGCCCTGTTCGCAGCATG
CGTGACGTTGCTCGTCGCCCAAAGAGCGTCTCGCCGCCCTCTTTGCGAGACGAACATGAACACTCGCGGACCCGA
TTTGTGGAGCGCGAACGCATCCGCCATCGCTCGCCCTCTGCTCCGCCCGTCAGGTTTGTTCGAGCCAGATCTCCT
ACACCCGTGGACCAAGAGCGTGAGCGAATTCGCACTCGCATTGTCGAGAAGGAAAAGGAACGCATGCCCTCGCCC
TCGCCCTCACCACCACCTCCGCCAGTAATTCGTGGTCCGACGATTGAACGAGAAGTCATCACGCACTGGACTGAT
GTCGATCATGGTGTTGTGCGAGCCAGACCTCCTAGCCCAGCCCCGCCTCCTCGTCCGCGAGCAAGAGAACGAGAA
ACAGACATTGACATTTCCTTGTCCAAAAATCGGACCGAGGTGGATATCTATCAGTCCAACTCAAGGCCGCGTTCC
AAGAGCCGCGACCGCCGTTCGCGATACTACGAAGATGATGTGGTTGTTCGGCGTGATGGCGAACGCCTCCGGATA
GACGAACACTCCTCTAGTTCACGTCGACGAGCGCAATCAGCGGCGCCCTCGACTATCCCATTTGACGACGAGGCT
GACCATATTACATCCAAGATTGACTCTCGTGGACGCATGGGCGAGTCGCGCGGCGGTGCAACCAAAGACTGGACC
ATTGTTGATGTACCGCCAGGCACTGAGAGAGTCCGCATGGACGGCATCGGAGGCGCAAGCACAGACACGACGTGG
GAGCGCTATAGTGGAGTGAGGCGGACACAGTTCATTCCCGAGAGAGATGGAGTGCTTGTGCCCAGAGACCCATCG
CCAGCCCCGACTCGAGATCGCTCCAGCATGGCCATCTACGACCGTGAACGTGAAATTGATGTCGACATTGATCGC
CGAGTAACCAGAACGCCCCTTTTGCCTCCGCCGCCACCAGCTCCCGCCAAGGACATGTGGACCGAGATCACCAAG
GATCTTGTCATGCGTGAGGCCATTGAGGAGTTGGGGTACGAGTATGAGGAGACGAGAGAGTTCTTCTACATCATG
GACTACCTGAAATACGAAGATGTATGCGAGCTTACAGAGCGATCTGAAAGCATCCGACGCGCCCGCAAGGATCGT
GTGAGGGAGATTCAGTGGGAGCGAGACTGGCGAGACGAATGGGAGCGACCATTTAGACGCCAGCATTATCGCGAC
CACCACGACCACTGGAGGTCTTCGCGTGAAGAATGGGATGATGAACGGATTAGGGAACGCGAGGTCATGTTTGAC
AGCCGAAGGCCCACCTATGGCTATCTTCGCTAG
Transcript >OphauB2|5099
ATGTCTCGTCGCAGCGTGAGAATGACCGAATTTGAGGAGCGAGACCACTTGCCACACCCTCGCCGCTCTGCCCCC
GAGCTGGATGAAGCAGACTACCGTTCTCGTGGCGCCAGGCCCCGCGTGGCCACGCGTGAAGTGGACGAGGTGGAT
ATCCGCATGCAGAGGGAGGATCGCACGCCCGCCTTTTTAAGAGATGACGCCCGCCGTTCAGAGGCTGGGCCCATG
GTTTTGCGCAAGCGCGACGTCGAGTATTATGATCGCCACAATCCCAGAAGAAGCCCCAGCCCTGTTCGCAGCATG
CGTGACGTTGCTCGTCGCCCAAAGAGCGTCTCGCCGCCCTCTTTGCGAGACGAACATGAACACTCGCGGACCCGA
TTTGTGGAGCGCGAACGCATCCGCCATCGCTCGCCCTCTGCTCCGCCCGTCAGGTTTGTTCGAGCCAGATCTCCT
ACACCCGTGGACCAAGAGCGTGAGCGAATTCGCACTCGCATTGTCGAGAAGGAAAAGGAACGCATGCCCTCGCCC
TCGCCCTCACCACCACCTCCGCCAGTAATTCGTGGTCCGACGATTGAACGAGAAGTCATCACGCACTGGACTGAT
GTCGATCATGGTGTTGTGCGAGCCAGACCTCCTAGCCCAGCCCCGCCTCCTCGTCCGCGAGCAAGAGAACGAGAA
ACAGACATTGACATTTCCTTGTCCAAAAATCGGACCGAGGTGGATATCTATCAGTCCAACTCAAGGCCGCGTTCC
AAGAGCCGCGACCGCCGTTCGCGATACTACGAAGATGATGTGGTTGTTCGGCGTGATGGCGAACGCCTCCGGATA
GACGAACACTCCTCTAGTTCACGTCGACGAGCGCAATCAGCGGCGCCCTCGACTATCCCATTTGACGACGAGGCT
GACCATATTACATCCAAGATTGACTCTCGTGGACGCATGGGCGAGTCGCGCGGCGGTGCAACCAAAGACTGGACC
ATTGTTGATGTACCGCCAGGCACTGAGAGAGTCCGCATGGACGGCATCGGAGGCGCAAGCACAGACACGACGTGG
GAGCGCTATAGTGGAGTGAGGCGGACACAGTTCATTCCCGAGAGAGATGGAGTGCTTGTGCCCAGAGACCCATCG
CCAGCCCCGACTCGAGATCGCTCCAGCATGGCCATCTACGACCGTGAACGTGAAATTGATGTCGACATTGATCGC
CGAGTAACCAGAACGCCCCTTTTGCCTCCGCCGCCACCAGCTCCCGCCAAGGACATGTGGACCGAGATCACCAAG
GATCTTGTCATGCGTGAGGCCATTGAGGAGTTGGGGTACGAGTATGAGGAGACGAGAGAGTTCTTCTACATCATG
GACTACCTGAAATACGAAGATGTATGCGAGCTTACAGAGCGATCTGAAAGCATCCGACGCGCCCGCAAGGATCGT
GTGAGGGAGATTCAGTGGGAGCGAGACTGGCGAGACGAATGGGAGCGACCATTTAGACGCCAGCATTATCGCGAC
CACCACGACCACTGGAGGTCTTCGCGTGAAGAATGGGATGATGAACGGATTAGGGAACGCGAGGTCATGTTTGAC
AGCCGAAGGCCCACCTATGGCTATCTTCGCTAG
Gene >OphauB2|5099
ATGTCTCGTCGCAGCGTGAGAATGACCGAATTTGAGGAGCGAGACCACTTGCCACACCCTCGCCGCTCTGCCCCC
GAGCTGGATGAAGCAGACTACCGTTCTCGTGGCGCCAGGCCCCGCGTGGCCACGCGTGAAGTGGACGAGGTGGAT
ATCCGCATGCAGAGGGAGGATCGCACGCCCGCCTTTTTAAGAGATGACGCCCGCCGTTCAGAGGCTGGGCCCATG
GTTTTGCGCAAGCGCGACGTCGAGTATTATGATCGCCACAATCCCAGAAGAAGCCCCAGCCCTGTTCGCAGCATG
CGTGACGTTGCTCGTCGCCCAAAGAGCGTCTCGCCGCCCTCTTTGCGAGACGAACATGAACACTCGCGGACCCGA
TTTGTGGAGCGCGAACGCATCCGCCATCGCTCGCCCTCTGCTCCGCCCGTCAGGTTTGTTCGAGCCAGATCTCCT
ACACCCGTGGACCAAGAGCGTGAGCGAATTCGCACTCGCATTGTCGAGAAGGAAAAGGAACGCATGCCCTCGCCC
TCGCCCTCACCACCACCTCCGCCAGTAATTCGTGGTCCGACGATTGAACGAGAAGTCATCACGCACTGGACTGAT
GTCGATCATGGTATTTGACTCTAGACACAGTTATTATTTGTTTCTTGGCCCATAATCAGATACTTACAAAGGTAT
TATAGGTGTTGTGCGAGCCAGACCTCCTAGCCCAGCCCCGCCTCCTCGTCCGCGAGCAAGAGAACGAGAAACAGA
CATTGACATTTCCTTGTCCAAAAATCGGACCGAGGTGGATATCTATCAGTCCAACTCAAGGCCGCGTTCCAAGAG
CCGCGACCGCCGTTCGCGATACTACGAAGATGATGTGGTTGTTCGGCGTGATGGCGAACGCCTCCGGATAGACGA
ACACTCCTCTAGTTCACGTCGACGAGCGCAATCAGCGGCGCCCTCGACTATCCCATTTGACGACGAGGCTGACCA
TATTACATCCAAGATTGACTCTCGTGGACGCATGGGCGAGTCGCGCGGCGGTGCAACCAAAGACTGGACCATTGT
TGATGTACCGCCAGGCACTGAGAGAGTCCGCATGGACGGCATCGGAGGCGCAAGCACAGACACGACGTGGGAGCG
CTATAGTGGAGTGAGGCGGACACAGTTCATTCCCGAGAGAGATGGAGTGCTTGTGCCCAGAGACCCATCGCCAGC
CCCGACTCGAGATCGCTCCAGCATGGCCATCTACGACCGTGAACGTGAAATTGATGTCGACATTGATCGCCGAGT
AACCAGAACGCCCCTTTTGCCTCCGCCGCCACCAGCTCCCGCCAAGGACATGTGGACCGAGATCACCAAGGATCT
TGTCATGCGTGAGGCCATTGAGGAGTTGGGGTACGAGTATGAGGAGACGAGAGAGTTCTTCTACATCATGGACTA
CCTGAAATACGTAAGCGCCTGACACTACATGATGGCGAATCAAAGGCCAATATACTAACGCGTGTGCAGGAAGAT
GTATGCGAGCTTACAGAGCGATCTGAAAGCATCCGACGCGCCCGCAAGGATCGTGTGAGGGAGATTCAGTGGGAG
CGAGACTGGCGAGACGAATGGGAGCGACCATTTAGACGCCAGCATTATCGCGACCACCACGACCACTGGAGGTCT
TCGCGTGAAGAATGGGATGATGAACGGATTAGGGAACGCGAGGTCATGTTTGACAGCCGAAGGCCCACCTATGGC
TATCTTCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail