Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5097
Gene name
LocationContig_38:13459..15534
Strand-
Gene length (bp)2075
Transcript length (bp)2016
Coding sequence length (bp)2016
Protein length (aa) 672

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10156 Med17 Subunit 17 of Mediator complex 9.4E-88 19 424

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CV59|MED17_NEOFI Mediator of RNA polymerase II transcription subunit 17 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=srb4 PE=3 SV=1 3 511 2.0E-66
sp|Q1DLD2|MED17_COCIM Mediator of RNA polymerase II transcription subunit 17 OS=Coccidioides immitis (strain RS) GN=SRB4 PE=3 SV=1 5 492 1.0E-65
sp|Q4W9B7|MED17_ASPFU Mediator of RNA polymerase II transcription subunit 17 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=srb4 PE=3 SV=1 3 502 1.0E-62
sp|A1CLT5|MED17_ASPCL Mediator of RNA polymerase II transcription subunit 17 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=srb4 PE=3 SV=1 5 502 3.0E-59
sp|Q5B8A6|MED17_EMENI Mediator of RNA polymerase II transcription subunit 17 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=srb4 PE=3 SV=1 5 509 4.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CV59|MED17_NEOFI Mediator of RNA polymerase II transcription subunit 17 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=srb4 PE=3 SV=1 3 511 2.0E-66
sp|Q1DLD2|MED17_COCIM Mediator of RNA polymerase II transcription subunit 17 OS=Coccidioides immitis (strain RS) GN=SRB4 PE=3 SV=1 5 492 1.0E-65
sp|Q4W9B7|MED17_ASPFU Mediator of RNA polymerase II transcription subunit 17 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=srb4 PE=3 SV=1 3 502 1.0E-62
sp|A1CLT5|MED17_ASPCL Mediator of RNA polymerase II transcription subunit 17 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=srb4 PE=3 SV=1 5 502 3.0E-59
sp|Q5B8A6|MED17_EMENI Mediator of RNA polymerase II transcription subunit 17 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=srb4 PE=3 SV=1 5 509 4.0E-59
sp|Q2UJ16|MED17_ASPOR Mediator of RNA polymerase II transcription subunit 17 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=srb4 PE=3 SV=1 5 500 9.0E-59
sp|Q0CG59|MED17_ASPTN Mediator of RNA polymerase II transcription subunit 17 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=srb4 PE=3 SV=1 5 500 9.0E-57
sp|Q6C022|MED17_YARLI Mediator of RNA polymerase II transcription subunit 17 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB4 PE=3 SV=1 24 347 4.0E-28
sp|Q5AHZ7|MED17_CANAL Mediator of RNA polymerase II transcription subunit 17 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB4 PE=3 SV=2 11 407 3.0E-25
sp|A3LRF0|MED17_PICST Mediator of RNA polymerase II transcription subunit 17 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SRB4 PE=3 SV=3 13 432 3.0E-20
sp|Q6CR96|MED17_KLULA Mediator of RNA polymerase II transcription subunit 17 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SRB4 PE=3 SV=1 85 409 4.0E-14
sp|P32569|MED17_YEAST Mediator of RNA polymerase II transcription subunit 17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB4 PE=1 SV=1 22 408 2.0E-13
sp|Q75D58|MED17_ASHGO Mediator of RNA polymerase II transcription subunit 17 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SRB4 PE=3 SV=1 13 345 8.0E-12
sp|Q6FQ87|MED17_CANGA Mediator of RNA polymerase II transcription subunit 17 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SRB4 PE=3 SV=1 24 409 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0016592 mediator complex Yes
GO:0031323 regulation of cellular metabolic process No
GO:0005575 cellular_component No
GO:0010468 regulation of gene expression No
GO:0140110 transcription regulator activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:2001141 regulation of RNA biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0140513 nuclear protein-containing complex No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0032991 protein-containing complex No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup133
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7793
Ophiocordyceps australis map64 (Brazil) OphauB2|5097 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00778
Ophiocordyceps camponoti-floridani Ophcf2|03867
Ophiocordyceps camponoti-rufipedis Ophun1|5948
Ophiocordyceps camponoti-rufipedis Ophun1|6363
Ophiocordyceps kimflemingae Ophio5|1641
Ophiocordyceps kimflemingae Ophio5|2605
Ophiocordyceps kimflemingae Ophio5|3904
Ophiocordyceps subramaniannii Hirsu2|10680
Ophiocordyceps subramaniannii Hirsu2|1755
Ophiocordyceps subramaniannii Hirsu2|6804
Ophiocordyceps subramaniannii Hirsu2|9391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5097
MAAHDSPPLSLRPFPVADKEPKKLAELIARVNGQPGGFRALSESSLRQEISTRGQDDTAAVEEEDEEMADADSEG
GDDAASDAGLARLEVLKNVDMASNCALLTLDFLSLLLSKQNPSQASLTLSQQLRDMVGIGTMGADKLDDASPDAS
AAAAKEQAALGLTLMEITRARDAALQASRQLSREVEAEGRYWKSVMRIKRAGWSLCRVPQQRHTLAVRFGFSEAA
ADFRSNGLAPLRRGHSGSVHLDLGRLGGVSEAIVVTYQQHGKTVGRSVPCPSGSVAPSSALEQRVLEARNTIFAQ
ELWHELAREARTLAAYNVGLHGSRLTCHLSPASRILIQLLPLDDCPTVPDASLPENAAAQAVAASLHLLLSYAHR
YNELVRTRPIPPHMSRARAHSTTYSLLRPILARFGALSAMRSCTRYVGGLAASFRTAAFPASFVLRTPPLSPDES
SQSVSAAQSLVRSLLQPHEFLLHLKLMPGVAFSVRARTFLFPITTTHYHVLLPPDSPLRHSTSPFPDGYLSLRAL
YEYIDMAAARSLLTHALTKLDTVDGNLDRWVVGQGALMLRDSLGTTCDIRFCVGERNLPWLPQPAKDDEAAKLRP
ARNLATENTLDLPPFIRLLIVYKHDNEMRPKCFNWNRNSPNCENRSFDDAFCEAVNLVTQNLRNKSRDATL*
Coding >OphauB2|5097
ATGGCTGCTCACGACAGCCCGCCGCTCTCGCTGCGCCCCTTCCCTGTCGCGGACAAGGAGCCCAAGAAGCTGGCG
GAATTGATTGCTCGCGTCAACGGCCAGCCCGGAGGCTTTCGCGCCCTGTCGGAGAGCAGCCTGCGCCAAGAAATC
AGCACACGCGGCCAAGATGACACGGCGGCGGTGGAGGAGGAGGATGAGGAAATGGCGGATGCCGATAGTGAGGGC
GGCGACGATGCAGCCAGCGACGCCGGGCTGGCGCGCCTCGAGGTGCTGAAAAACGTCGACATGGCAAGCAACTGC
GCCCTGCTCACGCTCGACTTCCTCTCGCTGCTGCTCTCCAAGCAAAACCCCAGCCAGGCCAGCCTGACGCTGTCG
CAGCAGCTCCGCGACATGGTTGGCATTGGCACCATGGGCGCTGACAAGCTCGACGACGCCTCGCCCGACGCCAGC
GCCGCGGCAGCCAAGGAGCAGGCCGCCTTGGGCTTGACCCTGATGGAGATTACCAGGGCGCGCGACGCTGCTCTG
CAAGCCAGCCGCCAGCTCAGCCGCGAGGTCGAGGCCGAAGGCAGGTACTGGAAGAGCGTCATGAGGATCAAGAGG
GCGGGCTGGTCCCTCTGCCGAGTCCCGCAGCAGCGCCACACCCTGGCCGTGCGCTTTGGCTTCTCCGAGGCAGCT
GCCGACTTTAGGAGCAACGGCCTGGCTCCTCTGCGCCGCGGCCACAGCGGCAGCGTCCACCTCGACCTCGGCCGT
CTTGGCGGCGTCTCCGAGGCCATTGTCGTCACCTACCAGCAACACGGCAAGACTGTCGGCCGCTCTGTGCCCTGC
CCCTCGGGCTCTGTCGCCCCCTCGTCGGCCCTGGAGCAACGCGTCTTGGAAGCGCGCAACACCATTTTTGCCCAG
GAGCTGTGGCACGAGCTGGCGCGCGAGGCCCGCACTCTAGCCGCCTACAATGTTGGCCTCCACGGCTCGCGTCTG
ACGTGCCACTTGAGTCCCGCCTCGCGCATCCTCATCCAGCTGCTGCCCCTCGACGACTGTCCCACCGTCCCCGAC
GCGTCGCTGCCCGAAAACGCCGCCGCCCAGGCTGTTGCCGCCTCGCTACACCTTCTCCTCAGTTATGCCCACCGC
TACAACGAGCTGGTGCGCACCCGCCCCATTCCGCCTCACATGTCTCGCGCCCGCGCCCACTCCACCACCTACTCC
CTCCTGCGCCCCATCCTGGCCCGCTTCGGCGCCCTGTCCGCCATGCGCTCCTGTACGCGCTATGTCGGCGGTCTC
GCTGCTTCCTTTCGCACCGCCGCCTTCCCCGCCTCCTTTGTCCTGCGCACGCCGCCTCTGTCCCCCGACGAGTCC
TCTCAGTCCGTCTCGGCTGCCCAGTCGCTGGTGCGCAGCTTGTTGCAGCCCCACGAATTTCTTCTCCACCTCAAG
CTCATGCCCGGCGTCGCCTTTAGCGTCCGTGCACGCACCTTTCTCTTCCCCATAACCACGACCCACTATCACGTC
CTTTTGCCCCCTGATTCGCCCTTGCGCCACTCTACCAGCCCCTTTCCCGATGGCTATCTCTCCCTGAGGGCTTTG
TATGAGTACATTGACATGGCTGCTGCTCGCTCACTTCTCACCCACGCCCTGACCAAGTTGGACACTGTTGATGGC
AATCTGGACCGCTGGGTCGTTGGCCAAGGCGCCCTTATGCTTCGCGATAGCCTGGGCACTACCTGTGATATTCGC
TTCTGCGTCGGAGAACGGAACCTGCCATGGCTACCTCAACCAGCCAAAGACGATGAAGCGGCCAAATTGCGCCCC
GCCCGCAATCTTGCAACGGAAAACACCCTCGACCTACCGCCCTTTATCCGGCTATTAATTGTATACAAGCATGAC
AATGAGATGCGCCCCAAGTGCTTCAATTGGAATCGCAATAGCCCCAATTGCGAAAACCGGAGCTTTGATGACGCC
TTCTGTGAAGCTGTCAACCTTGTCACCCAAAATTTGCGCAATAAGAGCCGAGATGCTACTCTTTAA
Transcript >OphauB2|5097
ATGGCTGCTCACGACAGCCCGCCGCTCTCGCTGCGCCCCTTCCCTGTCGCGGACAAGGAGCCCAAGAAGCTGGCG
GAATTGATTGCTCGCGTCAACGGCCAGCCCGGAGGCTTTCGCGCCCTGTCGGAGAGCAGCCTGCGCCAAGAAATC
AGCACACGCGGCCAAGATGACACGGCGGCGGTGGAGGAGGAGGATGAGGAAATGGCGGATGCCGATAGTGAGGGC
GGCGACGATGCAGCCAGCGACGCCGGGCTGGCGCGCCTCGAGGTGCTGAAAAACGTCGACATGGCAAGCAACTGC
GCCCTGCTCACGCTCGACTTCCTCTCGCTGCTGCTCTCCAAGCAAAACCCCAGCCAGGCCAGCCTGACGCTGTCG
CAGCAGCTCCGCGACATGGTTGGCATTGGCACCATGGGCGCTGACAAGCTCGACGACGCCTCGCCCGACGCCAGC
GCCGCGGCAGCCAAGGAGCAGGCCGCCTTGGGCTTGACCCTGATGGAGATTACCAGGGCGCGCGACGCTGCTCTG
CAAGCCAGCCGCCAGCTCAGCCGCGAGGTCGAGGCCGAAGGCAGGTACTGGAAGAGCGTCATGAGGATCAAGAGG
GCGGGCTGGTCCCTCTGCCGAGTCCCGCAGCAGCGCCACACCCTGGCCGTGCGCTTTGGCTTCTCCGAGGCAGCT
GCCGACTTTAGGAGCAACGGCCTGGCTCCTCTGCGCCGCGGCCACAGCGGCAGCGTCCACCTCGACCTCGGCCGT
CTTGGCGGCGTCTCCGAGGCCATTGTCGTCACCTACCAGCAACACGGCAAGACTGTCGGCCGCTCTGTGCCCTGC
CCCTCGGGCTCTGTCGCCCCCTCGTCGGCCCTGGAGCAACGCGTCTTGGAAGCGCGCAACACCATTTTTGCCCAG
GAGCTGTGGCACGAGCTGGCGCGCGAGGCCCGCACTCTAGCCGCCTACAATGTTGGCCTCCACGGCTCGCGTCTG
ACGTGCCACTTGAGTCCCGCCTCGCGCATCCTCATCCAGCTGCTGCCCCTCGACGACTGTCCCACCGTCCCCGAC
GCGTCGCTGCCCGAAAACGCCGCCGCCCAGGCTGTTGCCGCCTCGCTACACCTTCTCCTCAGTTATGCCCACCGC
TACAACGAGCTGGTGCGCACCCGCCCCATTCCGCCTCACATGTCTCGCGCCCGCGCCCACTCCACCACCTACTCC
CTCCTGCGCCCCATCCTGGCCCGCTTCGGCGCCCTGTCCGCCATGCGCTCCTGTACGCGCTATGTCGGCGGTCTC
GCTGCTTCCTTTCGCACCGCCGCCTTCCCCGCCTCCTTTGTCCTGCGCACGCCGCCTCTGTCCCCCGACGAGTCC
TCTCAGTCCGTCTCGGCTGCCCAGTCGCTGGTGCGCAGCTTGTTGCAGCCCCACGAATTTCTTCTCCACCTCAAG
CTCATGCCCGGCGTCGCCTTTAGCGTCCGTGCACGCACCTTTCTCTTCCCCATAACCACGACCCACTATCACGTC
CTTTTGCCCCCTGATTCGCCCTTGCGCCACTCTACCAGCCCCTTTCCCGATGGCTATCTCTCCCTGAGGGCTTTG
TATGAGTACATTGACATGGCTGCTGCTCGCTCACTTCTCACCCACGCCCTGACCAAGTTGGACACTGTTGATGGC
AATCTGGACCGCTGGGTCGTTGGCCAAGGCGCCCTTATGCTTCGCGATAGCCTGGGCACTACCTGTGATATTCGC
TTCTGCGTCGGAGAACGGAACCTGCCATGGCTACCTCAACCAGCCAAAGACGATGAAGCGGCCAAATTGCGCCCC
GCCCGCAATCTTGCAACGGAAAACACCCTCGACCTACCGCCCTTTATCCGGCTATTAATTGTATACAAGCATGAC
AATGAGATGCGCCCCAAGTGCTTCAATTGGAATCGCAATAGCCCCAATTGCGAAAACCGGAGCTTTGATGACGCC
TTCTGTGAAGCTGTCAACCTTGTCACCCAAAATTTGCGCAATAAGAGCCGAGATGCTACTCTTTAA
Gene >OphauB2|5097
ATGGCTGCTCACGACAGCCCGCCGCTCTCGCTGCGCCCCTTCCCTGTCGCGGACAAGGAGCCCAAGAAGCTGGCG
GAATTGATTGCTCGCGTCAACGGCCAGCCCGGAGGCTTTCGCGCCCTGTCGGAGAGCAGCCTGCGCCAAGAAATC
AGCACACGCGGCCAAGATGACACGGCGGCGGTGGAGGAGGAGGATGAGGAAATGGCGGATGCCGATAGTGAGGGC
GGCGACGATGCAGCCAGCGACGCCGGGCTGGCGCGCCTCGAGGTGCTGAAAAACGTCGAGTAGGTATGCGTCTAG
CAACTGCAGGCCGCTGTCATGGCTGACCAGGGGTGCGCTGCAGCATGGCAAGCAACTGCGCCCTGCTCACGCTCG
ACTTCCTCTCGCTGCTGCTCTCCAAGCAAAACCCCAGCCAGGCCAGCCTGACGCTGTCGCAGCAGCTCCGCGACA
TGGTTGGCATTGGCACCATGGGCGCTGACAAGCTCGACGACGCCTCGCCCGACGCCAGCGCCGCGGCAGCCAAGG
AGCAGGCCGCCTTGGGCTTGACCCTGATGGAGATTACCAGGGCGCGCGACGCTGCTCTGCAAGCCAGCCGCCAGC
TCAGCCGCGAGGTCGAGGCCGAAGGCAGGTACTGGAAGAGCGTCATGAGGATCAAGAGGGCGGGCTGGTCCCTCT
GCCGAGTCCCGCAGCAGCGCCACACCCTGGCCGTGCGCTTTGGCTTCTCCGAGGCAGCTGCCGACTTTAGGAGCA
ACGGCCTGGCTCCTCTGCGCCGCGGCCACAGCGGCAGCGTCCACCTCGACCTCGGCCGTCTTGGCGGCGTCTCCG
AGGCCATTGTCGTCACCTACCAGCAACACGGCAAGACTGTCGGCCGCTCTGTGCCCTGCCCCTCGGGCTCTGTCG
CCCCCTCGTCGGCCCTGGAGCAACGCGTCTTGGAAGCGCGCAACACCATTTTTGCCCAGGAGCTGTGGCACGAGC
TGGCGCGCGAGGCCCGCACTCTAGCCGCCTACAATGTTGGCCTCCACGGCTCGCGTCTGACGTGCCACTTGAGTC
CCGCCTCGCGCATCCTCATCCAGCTGCTGCCCCTCGACGACTGTCCCACCGTCCCCGACGCGTCGCTGCCCGAAA
ACGCCGCCGCCCAGGCTGTTGCCGCCTCGCTACACCTTCTCCTCAGTTATGCCCACCGCTACAACGAGCTGGTGC
GCACCCGCCCCATTCCGCCTCACATGTCTCGCGCCCGCGCCCACTCCACCACCTACTCCCTCCTGCGCCCCATCC
TGGCCCGCTTCGGCGCCCTGTCCGCCATGCGCTCCTGTACGCGCTATGTCGGCGGTCTCGCTGCTTCCTTTCGCA
CCGCCGCCTTCCCCGCCTCCTTTGTCCTGCGCACGCCGCCTCTGTCCCCCGACGAGTCCTCTCAGTCCGTCTCGG
CTGCCCAGTCGCTGGTGCGCAGCTTGTTGCAGCCCCACGAATTTCTTCTCCACCTCAAGCTCATGCCCGGCGTCG
CCTTTAGCGTCCGTGCACGCACCTTTCTCTTCCCCATAACCACGACCCACTATCACGTCCTTTTGCCCCCTGATT
CGCCCTTGCGCCACTCTACCAGCCCCTTTCCCGATGGCTATCTCTCCCTGAGGGCTTTGTATGAGTACATTGACA
TGGCTGCTGCTCGCTCACTTCTCACCCACGCCCTGACCAAGTTGGACACTGTTGATGGCAATCTGGACCGCTGGG
TCGTTGGCCAAGGCGCCCTTATGCTTCGCGATAGCCTGGGCACTACCTGTGATATTCGCTTCTGCGTCGGAGAAC
GGAACCTGCCATGGCTACCTCAACCAGCCAAAGACGATGAAGCGGCCAAATTGCGCCCCGCCCGCAATCTTGCAA
CGGAAAACACCCTCGACCTACCGCCCTTTATCCGGCTATTAATTGTATACAAGCATGACAATGAGATGCGCCCCA
AGTGCTTCAATTGGAATCGCAATAGCCCCAATTGCGAAAACCGGAGCTTTGATGACGCCTTCTGTGAAGCTGTCA
ACCTTGTCACCCAAAATTTGCGCAATAAGAGCCGAGATGCTACTCTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail