Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5092
Gene name
LocationContig_38:195..1816
Strand+
Gene length (bp)1621
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00550 PP-binding Phosphopantetheine attachment site 4.0E-11 27 90
PF00550 PP-binding Phosphopantetheine attachment site 2.4E-10 134 197
PF00975 Thioesterase Thioesterase domain 3.2E-21 271 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 27 499 1.0E-80
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 20 500 9.0E-56
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 110 501 2.0E-45
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 272 371 1.0E-10
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 272 371 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 27 499 1.0E-80
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 20 500 9.0E-56
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 110 501 2.0E-45
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 272 371 1.0E-10
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 272 371 1.0E-07
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 272 371 1.0E-07
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 2 126 8.0E-07
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 320 373 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7086
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2314
Ophiocordyceps australis map64 (Brazil) OphauB2|5092 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6426

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5092
MSPVSTAIKSPPTACPEPVEHDATYGRVLKIIADEVRIDLSRLQPDCLFADLGLDSLLSLTVTSRINDEMGTSLP
PSLFARYPSVKDLRALLDAPLTDMPPDTPELLSGSHSVTEESRASTSAASDDESLSFVVRQAIATQTGMPAQELM
PDALLAQLGVDSLLSLSIADSVTQALGAEVSSKHFLDHETLGDMEAALGKALGLVAAAGADTVTKDALVTGEAII
APGADTATPDADTTVTPDADLLSAPPHATSILLHRPAAPAHASRANLFLLPDGSGSAASYAALAKLDAALTVYGI
NCPWRTAPLDMSQLGVTTRQVVAKFVAEMRRLQPHGPYLLGGWSAGGIFAYEAVRHLMAAGQRVDQLLLIDAPNP
VGLENPPPRMFDFFQRSGVFANMGSGKTVPPWLRHHFESVVDMLDSYKPQPLPSPPPPTLVVYARDGVCKDPSAP
QMETSPDDAREMLWLLHNRTDFSASGWASLLGPDSLTVCVLDHVNHFTMMNDGPHMDTMRHHARRAIMAAGS*
Coding >OphauB2|5092
ATGTCGCCAGTTTCAACAGCCATCAAGAGCCCGCCAACCGCTTGCCCCGAGCCCGTCGAGCACGATGCCACCTAT
GGCCGCGTCTTGAAAATCATTGCCGACGAGGTGCGCATCGACCTGTCTCGCCTGCAGCCCGACTGCCTGTTTGCC
GACCTCGGGCTTGACTCGCTGCTGTCCCTGACCGTCACCTCTCGCATCAATGACGAAATGGGCACCAGTCTTCCT
CCGTCGCTCTTTGCCCGCTATCCCAGCGTCAAGGACTTGCGCGCCCTGTTGGACGCGCCCCTGACCGACATGCCG
CCCGATACGCCCGAGTTGCTGTCGGGCTCGCACAGCGTGACTGAGGAATCACGCGCCTCAACCTCTGCTGCCAGC
GACGACGAGTCTCTCAGCTTTGTCGTGCGCCAGGCCATTGCCACCCAGACGGGCATGCCGGCCCAGGAGCTCATG
CCCGACGCGCTCTTGGCCCAGCTGGGCGTTGACTCGCTCCTCAGCCTCAGCATTGCAGACTCTGTCACCCAGGCC
CTTGGCGCCGAGGTGTCGAGCAAGCATTTCCTCGACCATGAGACGCTGGGCGACATGGAGGCTGCGCTCGGCAAG
GCGCTGGGGCTTGTAGCAGCCGCAGGCGCCGACACTGTCACCAAGGACGCCCTTGTTACAGGAGAGGCCATTATT
GCTCCAGGTGCCGATACTGCCACCCCAGACGCCGACACTACTGTCACCCCCGACGCCGACTTGCTCTCGGCCCCC
CCGCACGCCACCTCGATCCTCCTCCACCGTCCAGCCGCCCCCGCCCACGCCTCCCGCGCCAATCTCTTCCTCCTC
CCCGACGGCTCCGGCTCGGCCGCCTCGTATGCCGCCTTGGCCAAGCTGGATGCCGCATTGACCGTCTACGGCATC
AACTGCCCCTGGCGAACCGCGCCCCTCGACATGAGCCAACTTGGCGTCACCACGCGACAAGTCGTGGCCAAGTTT
GTCGCCGAGATGCGCCGCCTCCAGCCTCACGGACCCTACCTGCTGGGCGGTTGGTCCGCCGGCGGCATCTTTGCC
TACGAGGCGGTCCGCCACCTCATGGCGGCCGGCCAGCGCGTCGACCAACTGCTCCTCATTGACGCGCCCAACCCC
GTCGGCCTCGAGAACCCGCCCCCGCGCATGTTTGACTTTTTCCAGCGCTCCGGCGTCTTTGCCAACATGGGCAGC
GGCAAGACGGTGCCGCCGTGGCTGCGCCATCACTTTGAGTCTGTCGTCGACATGCTCGACAGCTACAAGCCCCAG
CCCTTGCCCTCGCCGCCGCCCCCGACCCTTGTCGTCTATGCCCGCGATGGCGTTTGCAAGGATCCGAGCGCGCCC
CAGATGGAAACGTCTCCCGACGATGCGCGAGAGATGCTCTGGCTGCTGCACAACCGCACCGACTTTTCTGCCAGT
GGCTGGGCCTCGCTGCTTGGCCCCGACAGCCTGACTGTGTGTGTCTTGGACCACGTCAACCACTTTACCATGATG
AATGATGGCCCTCACATGGACACGATGCGCCACCATGCTAGGCGCGCCATCATGGCAGCAGGCTCATAG
Transcript >OphauB2|5092
ATGTCGCCAGTTTCAACAGCCATCAAGAGCCCGCCAACCGCTTGCCCCGAGCCCGTCGAGCACGATGCCACCTAT
GGCCGCGTCTTGAAAATCATTGCCGACGAGGTGCGCATCGACCTGTCTCGCCTGCAGCCCGACTGCCTGTTTGCC
GACCTCGGGCTTGACTCGCTGCTGTCCCTGACCGTCACCTCTCGCATCAATGACGAAATGGGCACCAGTCTTCCT
CCGTCGCTCTTTGCCCGCTATCCCAGCGTCAAGGACTTGCGCGCCCTGTTGGACGCGCCCCTGACCGACATGCCG
CCCGATACGCCCGAGTTGCTGTCGGGCTCGCACAGCGTGACTGAGGAATCACGCGCCTCAACCTCTGCTGCCAGC
GACGACGAGTCTCTCAGCTTTGTCGTGCGCCAGGCCATTGCCACCCAGACGGGCATGCCGGCCCAGGAGCTCATG
CCCGACGCGCTCTTGGCCCAGCTGGGCGTTGACTCGCTCCTCAGCCTCAGCATTGCAGACTCTGTCACCCAGGCC
CTTGGCGCCGAGGTGTCGAGCAAGCATTTCCTCGACCATGAGACGCTGGGCGACATGGAGGCTGCGCTCGGCAAG
GCGCTGGGGCTTGTAGCAGCCGCAGGCGCCGACACTGTCACCAAGGACGCCCTTGTTACAGGAGAGGCCATTATT
GCTCCAGGTGCCGATACTGCCACCCCAGACGCCGACACTACTGTCACCCCCGACGCCGACTTGCTCTCGGCCCCC
CCGCACGCCACCTCGATCCTCCTCCACCGTCCAGCCGCCCCCGCCCACGCCTCCCGCGCCAATCTCTTCCTCCTC
CCCGACGGCTCCGGCTCGGCCGCCTCGTATGCCGCCTTGGCCAAGCTGGATGCCGCATTGACCGTCTACGGCATC
AACTGCCCCTGGCGAACCGCGCCCCTCGACATGAGCCAACTTGGCGTCACCACGCGACAAGTCGTGGCCAAGTTT
GTCGCCGAGATGCGCCGCCTCCAGCCTCACGGACCCTACCTGCTGGGCGGTTGGTCCGCCGGCGGCATCTTTGCC
TACGAGGCGGTCCGCCACCTCATGGCGGCCGGCCAGCGCGTCGACCAACTGCTCCTCATTGACGCGCCCAACCCC
GTCGGCCTCGAGAACCCGCCCCCGCGCATGTTTGACTTTTTCCAGCGCTCCGGCGTCTTTGCCAACATGGGCAGC
GGCAAGACGGTGCCGCCGTGGCTGCGCCATCACTTTGAGTCTGTCGTCGACATGCTCGACAGCTACAAGCCCCAG
CCCTTGCCCTCGCCGCCGCCCCCGACCCTTGTCGTCTATGCCCGCGATGGCGTTTGCAAGGATCCGAGCGCGCCC
CAGATGGAAACGTCTCCCGACGATGCGCGAGAGATGCTCTGGCTGCTGCACAACCGCACCGACTTTTCTGCCAGT
GGCTGGGCCTCGCTGCTTGGCCCCGACAGCCTGACTGTGTGTGTCTTGGACCACGTCAACCACTTTACCATGATG
AATGATGGCCCTCACATGGACACGATGCGCCACCATGCTAGGCGCGCCATCATGGCAGCAGGCTCATAG
Gene >OphauB2|5092
ATGTCGCCAGTTTCAACAGGTGCCGCGTTCTGTCCTCGACGGCCTGCTGCCCGCCCGGGCCCCTCCACCAGCCAT
CAAGAGCCCGCCAACCGCTTGCCCCGAGCCCGTCGAGCACGATGCCACCTATGGCCGCGTCTTGAAAATCATTGC
CGACGAGGTGCGCATCGACCTGTCTCGCCTGCAGCCCGACTGCCTGTTTGCCGACCTCGGGCTTGACTCGCTGCT
GTCCCTGACCGTCACCTCTCGCATCAATGACGAAATGGGCACCAGTCTTCCTCCGTCGCTCTTTGCCCGCTATCC
CAGCGTCAAGGACTTGCGCGCCCTGTTGGACGCGCCCCTGACCGACATGCCGCCCGATACGCCCGAGTTGCTGTC
GGGCTCGCACAGCGTGACTGAGGAATCACGCGCCTCAACCTCTGCTGCCAGCGACGACGAGTCTCTCAGCTTTGT
CGTGCGCCAGGCCATTGCCACCCAGACGGGCATGCCGGCCCAGGAGCTCATGCCCGACGCGCTCTTGGCCCAGCT
GGGCGTTGACTCGCTCCTCAGCCTCAGCATTGCAGACTCTGTCACCCAGGCCCTTGGCGCCGAGGTGTCGAGCAA
GCATTTCCTCGACCATGAGACGCTGGGCGACATGGAGGCTGCGCTCGGCAAGGCGCTGGGGCTTGTAGCAGCCGC
AGGCGCCGACACTGTCACCAAGGACGCCCTTGTTACAGGAGAGGCCATTATTGCTCCAGGTGCCGATACTGCCAC
CCCAGACGCCGACACTACTGTCACCCCCGACGCCGACTTGCTCTCGGCCCCCCCGCACGCCACCTCGATCCTCCT
CCACCGTCCAGCCGCCCCCGCCCACGCCTCCCGCGCCAATCTCTTCCTCCTCCCCGACGGCTCCGGCTCGGCCGC
CTCGTATGCCGCCTTGGCCAAGCTGGATGCCGCATTGACCGTCTACGGCATCAACTGCCCCTGGCGAACCGCGCC
CCTCGACATGAGCCAACTTGGCGTCACCACGCGACAAGTCGTGGCCAAGTTTGTCGCCGAGATGCGCCGCCTCCA
GCCTCACGGACCCTACCTGCTGGGCGGTTGGTCCGCCGGCGGCATCTTTGCCTACGAGGCGGTCCGCCACCTCAT
GGCGGCCGGCCAGCGCGTCGACCAACTGCTCCTCATTGACGCGCCCAACCCCGTCGGCCTCGAGAACCCGCCCCC
GCGCATGTTTGACTTTTTCCAGCGCTCCGGCGTCTTTGCCAACATGGGCAGCGGCAAGACGGTGCCGCCGTGGCT
GCGCCATCACTTTGAGTCTGTCGTCGACATGCTCGACAGCTACAAGCCCCAGCCCTTGCCCTCGCCGCCGCCCCC
GACCCTTGTCGTCTATGCCCGCGATGGCGTTTGCAAGGATCCGAGCGCGCCCCAGATGGAAACGTCTCCCGACGA
TGCGCGAGAGATGCTCTGGCTGCTGCACAACCGCACCGACTTTTCTGCCAGTGGCTGGGCCTCGCTGCTTGGCCC
CGACAGCCTGACTGTGTGTGTCTTGGACCACGTCAACCACTTTACCATGATGAATGATGGCCCTCACATGGACAC
GATGCGCCACCATGCTAGGCGCGCCATCATGGCAGCAGGCTCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail