Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5089
Gene name
LocationContig_377:91..3288
Strand+
Gene length (bp)3197
Transcript length (bp)2748
Coding sequence length (bp)2748
Protein length (aa) 916

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11916 Vac14_Fig4_bd Vacuolar protein 14 C-terminal Fig4p binding 4.7E-78 604 782
PF12755 Vac14_Fab1_bd Vacuolar 14 Fab1-binding region 4.9E-41 66 161
PF02985 HEAT HEAT repeat 5.8E-04 92 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06708|VAC14_YEAST Vacuole morphology and inheritance protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC14 PE=1 SV=1 7 849 0.0E+00
sp|P87145|VAC14_SCHPO Protein VAC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.03 PE=3 SV=1 7 851 0.0E+00
sp|Q68F38|VAC14_XENLA Protein VAC14 homolog OS=Xenopus laevis GN=vac14 PE=2 SV=1 382 840 2.0E-88
sp|Q80WQ2|VAC14_MOUSE Protein VAC14 homolog OS=Mus musculus GN=Vac14 PE=1 SV=1 382 846 5.0E-88
sp|Q80W92|VAC14_RAT Protein VAC14 homolog OS=Rattus norvegicus GN=Vac14 PE=1 SV=1 382 846 2.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06708|VAC14_YEAST Vacuole morphology and inheritance protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC14 PE=1 SV=1 7 849 0.0E+00
sp|P87145|VAC14_SCHPO Protein VAC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.03 PE=3 SV=1 7 851 0.0E+00
sp|Q68F38|VAC14_XENLA Protein VAC14 homolog OS=Xenopus laevis GN=vac14 PE=2 SV=1 382 840 2.0E-88
sp|Q80WQ2|VAC14_MOUSE Protein VAC14 homolog OS=Mus musculus GN=Vac14 PE=1 SV=1 382 846 5.0E-88
sp|Q80W92|VAC14_RAT Protein VAC14 homolog OS=Rattus norvegicus GN=Vac14 PE=1 SV=1 382 846 2.0E-87
sp|Q66L58|VAC14_DANRE Protein VAC14 homolog OS=Danio rerio GN=vac14 PE=2 SV=1 382 840 4.0E-87
sp|Q08AM6|VAC14_HUMAN Protein VAC14 homolog OS=Homo sapiens GN=VAC14 PE=1 SV=1 382 846 7.0E-86
sp|A2VE70|VAC14_BOVIN Protein VAC14 homolog OS=Bos taurus GN=VAC14 PE=2 SV=1 382 846 6.0E-84
sp|Q5ZIW5|VAC14_CHICK Protein VAC14 homolog OS=Gallus gallus GN=VAC14 PE=2 SV=1 382 842 2.0E-83
sp|Q9ZU97|VAC14_ARATH Protein VAC14 homolog OS=Arabidopsis thaliana GN=VAC14 PE=1 SV=2 1 421 2.0E-75
sp|Q66L58|VAC14_DANRE Protein VAC14 homolog OS=Danio rerio GN=vac14 PE=2 SV=1 10 282 6.0E-69
sp|Q08AM6|VAC14_HUMAN Protein VAC14 homolog OS=Homo sapiens GN=VAC14 PE=1 SV=1 10 282 7.0E-69
sp|Q68F38|VAC14_XENLA Protein VAC14 homolog OS=Xenopus laevis GN=vac14 PE=2 SV=1 10 283 1.0E-68
sp|A2VE70|VAC14_BOVIN Protein VAC14 homolog OS=Bos taurus GN=VAC14 PE=2 SV=1 7 282 5.0E-68
sp|Q80WQ2|VAC14_MOUSE Protein VAC14 homolog OS=Mus musculus GN=Vac14 PE=1 SV=1 7 282 5.0E-68
sp|Q80W92|VAC14_RAT Protein VAC14 homolog OS=Rattus norvegicus GN=Vac14 PE=1 SV=1 7 282 9.0E-68
sp|Q5ZIW5|VAC14_CHICK Protein VAC14 homolog OS=Gallus gallus GN=VAC14 PE=2 SV=1 10 282 3.0E-67
sp|Q9ZU97|VAC14_ARATH Protein VAC14 homolog OS=Arabidopsis thaliana GN=VAC14 PE=1 SV=2 523 787 1.0E-64
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5089
MSRAFSMDANIHRALTDKLYDKRKLGALELERIIREVVASNNKERLNDILDQLINDYAYAVHQPHARNGGLIGLA
AAAIALGPQLARYLAKIVPPVLACFTDQDARVRYYACEAMYNIAKVAKGEILVYFNSIFDQLCRLGADAELSVKN
GAELLDRLIKDIVSESASSYVSVLEAESEVEADGENKLALDRNNAVPSSPRTAFSLPRFIPLLKERIWVMNPFTR
QFLVGWITLLDSIPDLELVTYLPEFLAGLLKFLSDQNLDVRTATHSCLDKFLNEIKRIARVKKGLVESKKWRQGS
KRRRQDSGDTGSLHPDLEEGDEVYSDTVNDDDYDQGRDLDEDGGSSLDEDWIPGQDVEVNYKQILEILTATLDSP
LEEYCLLESLRWIVEFLNICPEEVLPFTPKILAHMLPAMASSKETIRQAAIRVNTCLMDYVVSLSDESVIGQSQQ
HQVAPSRLPLANTNDHKGDESMSTKASLSSFHEREATSPTPGSGPSWSGALPPSPVDLDYAAAVNSLTLLFLNDH
EATRVAALTWLIMLHRKAPRKVLAFNDGTFPALLKTLSDPSDAVVTKDLQLLSQISRHSEDDYFANFMVNLLQLF
STDRKLLETRGNLIIRQLCTSLSPERIYRTLADCIEKEEDVEFASTMVQNLNNNLITAPQLGEVRKRLRTLDTKD
GQTLFIALFRSWCYNAVATFSLCLLAQAYEQAYHLLQIFGELDMTVNLLIQVDKLVQLIESPVFTYLRLQLLEPE
KYPYLYKCMYGILMLLPQSSAFAALKNRLNSVSAIGYLQVVPRSTSTSSSSSNFDRPNRLKGRDEGGIRWVELLD
KFRSVQERARKTRRQMADGDDGASAGMSDLRISEPGFGTGQKEGRGVVSVLAPPKDSTPVAPIAPAKKTGLGRQF
GRLGGAVSGKSRRNQ*
Coding >OphauB2|5089
ATGTCTCGGGCGTTCTCTATGGATGCCAATATCCATCGAGCCTTGACAGACAAGCTCTACGATAAGCGCAAGCTA
GGTGCGCTCGAACTCGAGAGGATCATTCGAGAGGTAGTGGCGTCGAATAACAAAGAGCGACTCAACGACATTCTC
GATCAGCTCATCAACGATTACGCCTATGCCGTGCACCAGCCTCATGCCCGGAATGGCGGTCTTATAGGTCTGGCT
GCTGCTGCTATAGCTCTTGGCCCGCAACTCGCGCGATATCTCGCCAAAATTGTGCCTCCAGTGCTGGCATGCTTC
ACGGATCAGGATGCCAGGGTTAGATATTATGCCTGTGAAGCCATGTACAACATCGCAAAGGTGGCCAAAGGGGAG
ATCTTGGTATACTTTAACAGCATCTTTGATCAACTCTGTAGGCTCGGTGCCGATGCTGAGCTCTCGGTAAAAAAT
GGAGCCGAGCTGTTGGACCGACTCATCAAAGATATTGTTTCCGAGTCGGCATCTTCTTACGTGTCGGTGCTAGAG
GCCGAGTCCGAGGTCGAGGCTGACGGCGAGAACAAATTGGCACTCGACAGGAATAATGCAGTCCCGTCATCACCC
CGTACCGCCTTTTCACTGCCTCGGTTTATTCCACTGCTAAAGGAGCGCATTTGGGTTATGAATCCATTCACACGG
CAGTTCCTCGTTGGATGGATCACTCTCCTCGATTCCATACCCGACTTGGAACTCGTCACCTACCTGCCCGAGTTT
CTGGCAGGTCTGCTCAAGTTTCTGAGTGATCAGAATCTTGACGTGCGGACTGCCACGCACTCGTGCCTCGACAAG
TTTCTTAATGAGATTAAGCGAATTGCACGAGTCAAGAAGGGTCTGGTTGAGAGCAAGAAATGGCGCCAGGGCAGC
AAGCGGAGGCGCCAAGACTCTGGCGACACAGGCAGCTTGCATCCTGATCTAGAAGAAGGCGACGAAGTCTACTCG
GACACAGTCAATGACGACGATTATGACCAAGGACGTGACCTGGATGAGGATGGTGGCAGTAGTTTGGATGAGGAC
TGGATTCCTGGTCAGGATGTCGAGGTTAATTACAAGCAAATATTGGAGATTTTGACTGCAACACTTGATTCTCCA
CTGGAAGAGTATTGCCTGTTGGAGTCTCTAAGATGGATCGTCGAATTTCTCAACATTTGCCCTGAAGAAGTGCTG
CCATTTACACCCAAGATACTTGCTCACATGTTGCCAGCCATGGCCAGCAGCAAGGAAACAATTCGTCAAGCGGCA
ATCAGGGTCAATACCTGTCTAATGGACTACGTTGTCTCACTATCTGACGAGTCTGTTATAGGCCAAAGCCAACAA
CATCAAGTCGCCCCTTCACGGCTTCCACTGGCCAATACCAATGACCACAAGGGAGACGAGAGCATGAGCACCAAA
GCATCATTGTCGAGTTTCCATGAACGGGAAGCAACGAGCCCGACGCCTGGCTCAGGGCCGTCTTGGTCTGGTGCA
CTGCCTCCTTCGCCCGTTGACCTCGACTATGCGGCAGCCGTTAACTCGCTCACTTTACTCTTCCTCAACGACCAC
GAGGCAACAAGAGTGGCTGCTTTGACATGGCTCATTATGCTTCACCGCAAGGCTCCTCGCAAGGTGCTGGCCTTC
AACGACGGCACCTTTCCCGCACTTCTCAAGACACTGTCAGATCCTTCTGACGCTGTCGTCACCAAGGATCTCCAG
CTCTTATCACAGATTTCGCGTCATAGCGAGGACGACTATTTTGCAAATTTCATGGTCAACCTCTTGCAGCTCTTC
TCGACAGATCGCAAACTCTTGGAAACTCGAGGAAATCTCATTATTCGCCAGCTGTGCACAAGTCTCAGCCCAGAG
CGTATATACCGCACGCTGGCTGACTGCATTGAAAAGGAGGAGGATGTTGAGTTTGCTAGCACAATGGTGCAGAAC
CTCAACAATAACCTCATCACGGCACCTCAGCTTGGCGAGGTGCGTAAGAGGCTGCGCACCCTCGACACAAAAGAC
GGTCAAACCTTGTTTATAGCGCTGTTTCGATCATGGTGCTACAATGCCGTGGCAACATTTTCGCTCTGCTTGCTG
GCCCAGGCGTACGAACAGGCTTATCATTTGTTACAAATCTTTGGCGAGCTGGACATGACTGTCAATCTTTTGATT
CAAGTCGATAAACTAGTACAGCTGATTGAGTCCCCCGTCTTCACCTATCTAAGACTGCAATTATTGGAACCGGAA
AAGTATCCCTATTTATACAAGTGCATGTACGGTATCCTCATGCTCCTGCCACAGTCGTCGGCTTTTGCCGCTCTG
AAGAACCGGCTCAACAGTGTGAGTGCTATAGGCTATCTGCAGGTTGTGCCTCGAAGCACCTCGACGTCTAGTAGT
AGCTCGAACTTTGATCGGCCGAATCGGCTTAAAGGACGCGACGAAGGAGGTATTCGATGGGTCGAATTGCTGGAC
AAGTTCCGCAGCGTGCAAGAAAGAGCCAGGAAAACACGGCGACAAATGGCGGACGGCGATGACGGGGCTTCAGCT
GGCATGAGCGATTTGCGCATAAGTGAGCCAGGCTTTGGAACAGGGCAGAAAGAGGGCCGTGGTGTGGTATCGGTA
CTGGCACCACCCAAAGACTCGACACCAGTGGCACCAATTGCGCCCGCGAAAAAGACTGGACTGGGTAGGCAGTTT
GGTCGACTGGGAGGTGCTGTATCTGGTAAGAGCCGACGAAATCAGTAG
Transcript >OphauB2|5089
ATGTCTCGGGCGTTCTCTATGGATGCCAATATCCATCGAGCCTTGACAGACAAGCTCTACGATAAGCGCAAGCTA
GGTGCGCTCGAACTCGAGAGGATCATTCGAGAGGTAGTGGCGTCGAATAACAAAGAGCGACTCAACGACATTCTC
GATCAGCTCATCAACGATTACGCCTATGCCGTGCACCAGCCTCATGCCCGGAATGGCGGTCTTATAGGTCTGGCT
GCTGCTGCTATAGCTCTTGGCCCGCAACTCGCGCGATATCTCGCCAAAATTGTGCCTCCAGTGCTGGCATGCTTC
ACGGATCAGGATGCCAGGGTTAGATATTATGCCTGTGAAGCCATGTACAACATCGCAAAGGTGGCCAAAGGGGAG
ATCTTGGTATACTTTAACAGCATCTTTGATCAACTCTGTAGGCTCGGTGCCGATGCTGAGCTCTCGGTAAAAAAT
GGAGCCGAGCTGTTGGACCGACTCATCAAAGATATTGTTTCCGAGTCGGCATCTTCTTACGTGTCGGTGCTAGAG
GCCGAGTCCGAGGTCGAGGCTGACGGCGAGAACAAATTGGCACTCGACAGGAATAATGCAGTCCCGTCATCACCC
CGTACCGCCTTTTCACTGCCTCGGTTTATTCCACTGCTAAAGGAGCGCATTTGGGTTATGAATCCATTCACACGG
CAGTTCCTCGTTGGATGGATCACTCTCCTCGATTCCATACCCGACTTGGAACTCGTCACCTACCTGCCCGAGTTT
CTGGCAGGTCTGCTCAAGTTTCTGAGTGATCAGAATCTTGACGTGCGGACTGCCACGCACTCGTGCCTCGACAAG
TTTCTTAATGAGATTAAGCGAATTGCACGAGTCAAGAAGGGTCTGGTTGAGAGCAAGAAATGGCGCCAGGGCAGC
AAGCGGAGGCGCCAAGACTCTGGCGACACAGGCAGCTTGCATCCTGATCTAGAAGAAGGCGACGAAGTCTACTCG
GACACAGTCAATGACGACGATTATGACCAAGGACGTGACCTGGATGAGGATGGTGGCAGTAGTTTGGATGAGGAC
TGGATTCCTGGTCAGGATGTCGAGGTTAATTACAAGCAAATATTGGAGATTTTGACTGCAACACTTGATTCTCCA
CTGGAAGAGTATTGCCTGTTGGAGTCTCTAAGATGGATCGTCGAATTTCTCAACATTTGCCCTGAAGAAGTGCTG
CCATTTACACCCAAGATACTTGCTCACATGTTGCCAGCCATGGCCAGCAGCAAGGAAACAATTCGTCAAGCGGCA
ATCAGGGTCAATACCTGTCTAATGGACTACGTTGTCTCACTATCTGACGAGTCTGTTATAGGCCAAAGCCAACAA
CATCAAGTCGCCCCTTCACGGCTTCCACTGGCCAATACCAATGACCACAAGGGAGACGAGAGCATGAGCACCAAA
GCATCATTGTCGAGTTTCCATGAACGGGAAGCAACGAGCCCGACGCCTGGCTCAGGGCCGTCTTGGTCTGGTGCA
CTGCCTCCTTCGCCCGTTGACCTCGACTATGCGGCAGCCGTTAACTCGCTCACTTTACTCTTCCTCAACGACCAC
GAGGCAACAAGAGTGGCTGCTTTGACATGGCTCATTATGCTTCACCGCAAGGCTCCTCGCAAGGTGCTGGCCTTC
AACGACGGCACCTTTCCCGCACTTCTCAAGACACTGTCAGATCCTTCTGACGCTGTCGTCACCAAGGATCTCCAG
CTCTTATCACAGATTTCGCGTCATAGCGAGGACGACTATTTTGCAAATTTCATGGTCAACCTCTTGCAGCTCTTC
TCGACAGATCGCAAACTCTTGGAAACTCGAGGAAATCTCATTATTCGCCAGCTGTGCACAAGTCTCAGCCCAGAG
CGTATATACCGCACGCTGGCTGACTGCATTGAAAAGGAGGAGGATGTTGAGTTTGCTAGCACAATGGTGCAGAAC
CTCAACAATAACCTCATCACGGCACCTCAGCTTGGCGAGGTGCGTAAGAGGCTGCGCACCCTCGACACAAAAGAC
GGTCAAACCTTGTTTATAGCGCTGTTTCGATCATGGTGCTACAATGCCGTGGCAACATTTTCGCTCTGCTTGCTG
GCCCAGGCGTACGAACAGGCTTATCATTTGTTACAAATCTTTGGCGAGCTGGACATGACTGTCAATCTTTTGATT
CAAGTCGATAAACTAGTACAGCTGATTGAGTCCCCCGTCTTCACCTATCTAAGACTGCAATTATTGGAACCGGAA
AAGTATCCCTATTTATACAAGTGCATGTACGGTATCCTCATGCTCCTGCCACAGTCGTCGGCTTTTGCCGCTCTG
AAGAACCGGCTCAACAGTGTGAGTGCTATAGGCTATCTGCAGGTTGTGCCTCGAAGCACCTCGACGTCTAGTAGT
AGCTCGAACTTTGATCGGCCGAATCGGCTTAAAGGACGCGACGAAGGAGGTATTCGATGGGTCGAATTGCTGGAC
AAGTTCCGCAGCGTGCAAGAAAGAGCCAGGAAAACACGGCGACAAATGGCGGACGGCGATGACGGGGCTTCAGCT
GGCATGAGCGATTTGCGCATAAGTGAGCCAGGCTTTGGAACAGGGCAGAAAGAGGGCCGTGGTGTGGTATCGGTA
CTGGCACCACCCAAAGACTCGACACCAGTGGCACCAATTGCGCCCGCGAAAAAGACTGGACTGGGTAGGCAGTTT
GGTCGACTGGGAGGTGCTGTATCTGGTAAGAGCCGACGAAATCAGTAG
Gene >OphauB2|5089
ATGTCTCGGGCGTTCTCTATGGATGCCAATATCCATCGAGCCTTGACAGACAAGCTCTACGATAAGCGCAAGCTA
GGTGCGCTCGAGTTGGTCTCCTCATGCATATCGAAGCCAAGTGTGCACGGGGCTAACGCTCCGGCAGACTCGAGA
GGATCATTCGAGAGGTAGTGGCGTCGAATAACAAAGAGCGACTCAACGACATTCTCGATCAGCTCATCAACGATT
ACGCCTATGCCGTGCACCAGCCTCATGCCCGGAATGGCGGTCTTATAGGTCTGGCTGCTGCTGCTATAGCTCTTG
GCCCGGTCCGTCAAACCCTATCTCCCATTATACAAGACTGTTTGGATCACTGATGCTAGCAGCGCTGTCTGGCCT
TGGTTTTCCAATAGCAACTCGCGCGATATCTCGCCAAAATTGTGCCTCCAGTGCTGGCATGCTTCACGGATCAGG
ATGCCAGGGTTAGATATTATGCCTGTGAAGCCATGTACAACATCGCAAAGGTGGCCAAAGGGGAGATCTTGGTAT
ACTTTAACAGCATCTTTGATCAACTCTGTAGGGTACGCTGTCTCGCTGGGTGCAGAGCCGGGAAGCGCGCTTTGC
TAATATGATCAGCTCGGTGCCGATGCTGAGCTCTCGGTAAAAAATGGAGCCGAGCTGTTGGACCGACTCATCAAA
GATATTGTTTCCGAGTCGGCATCTTCTTACGTGTCGGTGCTAGAGGCCGAGTCCGAGGTCGAGGCTGACGGCGAG
AACAAATTGGCACTCGACAGGAATAATGCAGTCCCGTCATCACCCCGTACCGCCTTTTCACTGCCTCGGTTTATT
CCACTGCTAAAGGAGCGCATTTGGGTTATGAATCCATTCACACGGCAGTTCCTCGTTGGATGGATCACTCTCCTC
GATTCCATACCCGACTTGGAACTCGTCACCTACCTGCCCGAGTTTCTGGCAGGTCTGCTCAAGTTTCTGAGTGAT
CAGAATCTTGACGTGCGGACTGCCACGCACTCGTGCCTCGACAAGTTTCTTAATGAGATTAAGCGAATTGCACGA
GTCAAGAAGGGTCTGGTTGAGAGCAAGAAATGGCGCCAGGGCAGCAAGCGGAGGCGCCAAGACTCTGGCGACACA
GGCAGCTTGCATCCTGATCTAGAAGAAGGCGACGAAGTCTACTCGGACACAGTCAATGACGACGATTATGACCAA
GGACGTGACCTGGATGAGGATGGTGGCAGTAGTTTGGATGAGGACTGGATTCCTGGTCAGGATGTCGAGGTTAAT
TACAAGCAAATATTGGAGATTTTGACTGCAACACTTGATTCTCCACTGGGTACGTGTTGTCATGTTTGCCGAGCC
CAGGGCGTCCTGAAAAGCTGACGAATAGGTGATACATGGCAGAAGAGTATTGCCTGTTGGAGTCTCTAAGATGGA
TCGTCGAATTTCTCAACATTTGCCCTGAAGAAGTGCTGCCATTTACACCCAAGATACTTGCTCACATGTTGCCAG
CCATGGCCAGCAGCAAGGAAACAATTCGTCAAGCGGCAATCAGGGTCAATACCTGTCTAATGGACTACGTTGTCT
CACTATCTGACGAGTCTGTTATAGGCCAAAGCCAACAACATCAAGTCGCCCCTTCACGGCTTCCACTGGCCAATA
CCAATGACCACAAGGGAGACGAGAGCATGAGCACCAAAGCATCATTGTCGAGTTTCCATGAACGGGAAGCAACGA
GCCCGACGCCTGGCTCAGGGCCGTCTTGGTCTGGTGCACTGCCTCCTTCGCCCGTTGACCTCGACTATGCGGCAG
CCGTTAACTCGCTCACTTTACTCTTCCTCAACGACCACGAGGCAACAAGAGTGGCTGCTTTGACATGGCTCATTA
TGCTTCACCGCAAGGCTCCTCGCAAGGTGCTGGCCTTCAACGACGGCACCTTTCCCGCACTTCTCAAGACACTGT
CAGATCCTTCTGACGCTGTCGTCACCAAGGATCTCCAGCTCTTATCACAGATTTCGCGTCATAGCGAGGACGACT
ATTTTGCAAATTTCATGGTCAACCTCTTGCAGCTCTTCTCGACAGATCGCAAACTCTTGGAAACTCGAGGAAATC
TCATTATTCGCCAGCTGTGCACAAGTCTCAGCCCAGAGCGTATATACCGCACGCTGGCTGACTGCATTGAAAAGG
AGGAGGATGTTGAGTTTGCTAGCACAATGGTGCAGAACCTCAACAATAACCTCATCACGGCACCTCAGCTTGGCG
AGGTGCGTAAGAGGCTGCGCACCCTCGACACAAAAGACGGTCAAACCTTGTTTATAGCGCTGTTTCGATCATGGT
GCTACAATGCCGTGGCAACATTTTCGCTCTGCTTGCTGGCCCAGGCGTACGAACAGGCTTATCATTTGTTACAAA
TCTTGTCAGCATGAACTTTGCCTGTTGCTAAATCGAGTATCGTCATACTGACATTCGACAGTGGCGAGCTGGACA
TGACTGTCAATCTTTTGATTCAAGTCGATAAACTAGTACAGCTGATTGAGTCCCCCGTCTTCACCTGTGCGTTGC
ATGCACCTGATTAATACTGCCACAATAGTTACTGATTGATTCCTTGGGCAGATCTAAGACTGCAATTATTGGAAC
CGGAAAAGTATCCCTATTTATACAAGTGCATGTACGGTATCCTCATGCTCCTGCCACAGTCGTCGGCTTTTGCCG
CTCTGAAGAACCGGCTCAACAGTGTGAGTGCTATAGGCTATCTGCAGGTTGTGCCTCGAAGGTGAGTGACCTTTA
TTTCCATGGCGCACTGCGAGCCATGAGGGCAAAATTGTGACCAGAGGCAACACAGCACCTCGACGTCTAGTAGTA
GCTCGAACTTTGATCGGCCGAATCGGCTTAAAGGACGCGACGAAGGAGGTATTCGATGGGTCGAATTGCTGGACA
AGTTCCGCAGCGTGCAAGAAAGAGCCAGGAAAACACGGCGACAAATGGCGGACGGCGATGACGGGGCTTCAGCTG
GCATGAGCGATTTGCGCATAAGTGAGCCAGGCTTTGGAACAGGGCAGAAAGAGGGCCGTGGTGTGGTATCGGTAC
TGGCACCACCCAAAGACTCGACACCAGTGGCACCAATTGCGCCCGCGAAAAAGACTGGACTGGGTAGGCAGTTTG
GTCGACTGGGAGGTGCTGTATCTGGTAAGAGCCGACGAAATCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail