Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5083
Gene name
LocationContig_371:290..1227
Strand+
Gene length (bp)937
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 1.8E-10 170 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 61 234 3.0E-10
sp|Q2KIY1|PXMP2_BOVIN Peroxisomal membrane protein 2 OS=Bos taurus GN=PXMP2 PE=2 SV=3 58 231 5.0E-10
sp|Q9ZS51|PMP22_ARATH Peroxisomal membrane protein PMP22 OS=Arabidopsis thaliana GN=PMP22 PE=1 SV=1 55 241 9.0E-10
sp|Q54FR4|PX24D_DICDI PXMP2/4 family protein 4 OS=Dictyostelium discoideum GN=DDB_G0290631 PE=3 SV=1 61 230 2.0E-08
sp|Q4IPX8|SYM1_GIBZE Protein SYM1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SYM1 PE=3 SV=1 57 232 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 61 234 3.0E-10
sp|Q2KIY1|PXMP2_BOVIN Peroxisomal membrane protein 2 OS=Bos taurus GN=PXMP2 PE=2 SV=3 58 231 5.0E-10
sp|Q9ZS51|PMP22_ARATH Peroxisomal membrane protein PMP22 OS=Arabidopsis thaliana GN=PMP22 PE=1 SV=1 55 241 9.0E-10
sp|Q54FR4|PX24D_DICDI PXMP2/4 family protein 4 OS=Dictyostelium discoideum GN=DDB_G0290631 PE=3 SV=1 61 230 2.0E-08
sp|Q4IPX8|SYM1_GIBZE Protein SYM1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SYM1 PE=3 SV=1 57 232 6.0E-08
sp|Q7SCY7|SYM1_NEUCR Protein sym-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sym-1 PE=3 SV=2 58 227 7.0E-07
sp|Q54XX9|PX24B_DICDI PXMP2/4 family protein 2 OS=Dictyostelium discoideum GN=DDB_G0278529 PE=3 SV=1 61 233 2.0E-06
sp|Q07066|PXMP2_RAT Peroxisomal membrane protein 2 OS=Rattus norvegicus GN=Pxmp2 PE=1 SV=2 58 231 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 110 132 22
2 145 167 22
3 210 229 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5168
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1062
Ophiocordyceps australis map64 (Brazil) OphauB2|5083 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01757
Ophiocordyceps camponoti-rufipedis Ophun1|995
Ophiocordyceps kimflemingae Ophio5|4958
Ophiocordyceps subramaniannii Hirsu2|3818

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5083
MSVKFERDTLKQTAHHAVSDMVATSKPIAGTSGKHVVAERIGTALTGGLQNAGSKGYLAAYIKQLESNPLRTKML
TAGSLAGTQELMASWLAKDRNKHGHYLTSRVPKMAAYGALVSAPLGHLLIWILQKAFRGRTSLSAKVMQILVSNL
IIAPIQNSIYLVAMALIAGARTHHQVRATVKVGFWRVMRVSWVTSPICLAFAQKFLPDELWVPFFNIVSFVIGTY
INTVTKKKRLAALRRKHFGEGRSSGIGRPDDYSASHMGSNPPY*
Coding >OphauB2|5083
ATGTCGGTCAAGTTTGAACGCGACACGTTGAAGCAAACGGCGCACCATGCAGTCTCGGACATGGTGGCCACGAGC
AAACCCATTGCTGGCACCAGCGGCAAGCATGTTGTTGCTGAAAGAATCGGCACTGCCCTCACGGGTGGCCTTCAG
AATGCCGGCTCCAAGGGTTATCTAGCTGCCTACATCAAGCAGCTCGAGTCGAATCCCCTGCGCACAAAGATGCTC
ACTGCTGGCTCTCTTGCCGGCACCCAGGAGCTCATGGCATCGTGGCTGGCCAAGGACCGCAACAAACATGGCCAC
TACTTGACGTCGCGCGTCCCCAAAATGGCGGCATACGGCGCCCTCGTGAGCGCGCCTCTGGGCCACCTTCTCATT
TGGATCTTGCAAAAGGCCTTTCGTGGTCGTACAAGCCTGAGTGCCAAGGTGATGCAGATTTTGGTCAGCAACCTC
ATTATTGCACCCATCCAAAACAGCATCTACTTGGTTGCCATGGCCCTCATTGCCGGTGCCCGCACCCATCACCAG
GTGCGCGCCACGGTCAAGGTCGGCTTCTGGAGAGTCATGCGCGTCTCTTGGGTCACTTCGCCCATTTGCCTGGCT
TTTGCCCAAAAGTTCCTGCCCGATGAGCTCTGGGTTCCTTTTTTCAACATTGTATCCTTCGTCATTGGCACTTAT
ATCAATACAGTCACCAAGAAAAAACGTCTGGCTGCATTGCGAAGGAAGCATTTTGGAGAAGGTCGCTCGAGTGGC
ATAGGTCGACCTGACGACTATTCTGCGAGCCATATGGGATCGAATCCTCCTTACTGA
Transcript >OphauB2|5083
ATGTCGGTCAAGTTTGAACGCGACACGTTGAAGCAAACGGCGCACCATGCAGTCTCGGACATGGTGGCCACGAGC
AAACCCATTGCTGGCACCAGCGGCAAGCATGTTGTTGCTGAAAGAATCGGCACTGCCCTCACGGGTGGCCTTCAG
AATGCCGGCTCCAAGGGTTATCTAGCTGCCTACATCAAGCAGCTCGAGTCGAATCCCCTGCGCACAAAGATGCTC
ACTGCTGGCTCTCTTGCCGGCACCCAGGAGCTCATGGCATCGTGGCTGGCCAAGGACCGCAACAAACATGGCCAC
TACTTGACGTCGCGCGTCCCCAAAATGGCGGCATACGGCGCCCTCGTGAGCGCGCCTCTGGGCCACCTTCTCATT
TGGATCTTGCAAAAGGCCTTTCGTGGTCGTACAAGCCTGAGTGCCAAGGTGATGCAGATTTTGGTCAGCAACCTC
ATTATTGCACCCATCCAAAACAGCATCTACTTGGTTGCCATGGCCCTCATTGCCGGTGCCCGCACCCATCACCAG
GTGCGCGCCACGGTCAAGGTCGGCTTCTGGAGAGTCATGCGCGTCTCTTGGGTCACTTCGCCCATTTGCCTGGCT
TTTGCCCAAAAGTTCCTGCCCGATGAGCTCTGGGTTCCTTTTTTCAACATTGTATCCTTCGTCATTGGCACTTAT
ATCAATACAGTCACCAAGAAAAAACGTCTGGCTGCATTGCGAAGGAAGCATTTTGGAGAAGGTCGCTCGAGTGGC
ATAGGTCGACCTGACGACTATTCTGCGAGCCATATGGGATCGAATCCTCCTTACTGA
Gene >OphauB2|5083
ATGTCGGTCAAGTTTGAACGCGACACGTTGAAGCAAACGGCGCACCATGCAGTCTCGGACATGGTGGCCACGAGC
AAACCCATTGCTGGCACCAGCGGCAAGCATGTTGTTGCTGAAAGAATCGGCACTGCCCTCACGGGTGGCCTTCAG
AATGCCGGCTCCAAGGGTTATCTAGCTGTGCGTTTGGCGTTCCCCTGGGTGCACTCTGGCGTCTGACTGTTTGCG
CCCCCTTGACTCTCTTCAGGCCTACATCAAGCAGCTCGAGTCGAATCCCCTGCGCACAAAGATGCTCACTGCTGG
CTCTCTTGCCGGCACCCAGGAGCTCATGGCATCGTGGCTGGCCAAGGACCGCAACAAACATGGCCACTACTTGAC
GTCGCGCGTCCCCAAAATGGCGGCATACGGCGCCCTCGTGAGCGCGCCTCTGGGCCACCTTCTCATTTGGATCTT
GCAAAAGGCCTTTCGTGGTCGTACAAGCCTGAGTGCCAAGGTGATGCAGATTTTGGTCAGCAACCTCATTGTACG
TGACTGCTTAGGGGCCAGATGTTTTGCCCACTAGCATTGTTGACTTGCCATGACACAGATTGCACCCATCCAAAA
CAGCATCTACTTGGTTGCCATGGCCCTCATTGCCGGTGCCCGCACCCATCACCAGGTGCGCGCCACGGTCAAGGT
CGGCTTCTGGAGAGTCATGCGCGTCTCTTGGGTCACTTCGCCCATTTGCCTGGCTTTTGCCCAAAAGTTCCTGCC
CGATGAGCTCTGGGTTCCTTTTTTCAACATTGTATCCTTCGTCATTGGCACTTATATCAATACAGTCACCAAGAA
AAAACGTCTGGCTGCATTGCGAAGGAAGCATTTTGGAGAAGGTCGCTCGAGTGGCATAGGTCGACCTGACGACTA
TTCTGCGAGCCATATGGGATCGAATCCTCCTTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail