Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|508
Gene name
LocationContig_109:13071..14696
Strand-
Gene length (bp)1625
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07808 RED_N RED-like protein N-terminal region 1.3E-09 77 199

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Z6|YP02_SCHPO Meiotic chromosome segregation protein C1539.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1539.02 PE=4 SV=1 1 329 9.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1332
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|219
Ophiocordyceps australis map64 (Brazil) OphauB2|508 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07269
Ophiocordyceps camponoti-rufipedis Ophun1|3055
Ophiocordyceps kimflemingae Ophio5|1895
Ophiocordyceps subramaniannii Hirsu2|10700

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|508
MNNEDFRKLVLAGTKQPSSAKDGPSSSATKQGGAGTLGLRQRSSFSLTPRAVLKSKTDLARKPAESDSSHHPRKK
FKTSDPKGVSLATGYVDRAQDRRSDEADDRHERLKALEASFRKGEIDQETYDEQRYAIAGGSLDSTHLVKGLDFK
LLQRVKRGEDVFGKTADDDVEEALDEFESKEVSTIEREKREKRGTFSTTAPETGQHRTRNQILAELKASRTAAKA
KQEASSLGDRFKRIGTKQNVETRIERDAKGREVLIIVDEHGNEKRKVRKLKSEEVAELLMPDPNAKPLGMEVPEQ
YRPQQEAEEEEEDQGSDIFGDVGDDYDPLAGIEASSSDSEQDGDHGEESTNKDRQQGQEASGSESEAGAMAPSPQ
PARRRNYFGDSKTGLLSQETTRAPSLSDPSIAAALKKAAALNHMQDSEATAKAKQDKQAMEERRQKLLQMSERDN
DDLDMGFGTSRFEDEDDADDTRVKLSAWGSGSHEERGGGQGKRKRGPKKRKGDANSAADVLRVMEQRKRP*
Coding >OphauB2|508
ATGAACAACGAAGATTTCCGCAAGCTGGTTCTCGCCGGGACCAAACAGCCATCCAGCGCCAAAGATGGCCCATCT
TCTTCAGCCACCAAACAGGGTGGCGCTGGCACGCTGGGGTTGCGACAGCGCTCCAGCTTTTCCTTGACACCGCGC
GCGGTCCTCAAGTCCAAGACTGATCTAGCACGAAAACCCGCCGAGTCAGATTCGAGCCACCACCCGAGGAAAAAA
TTCAAGACGTCGGATCCCAAAGGCGTCAGCCTGGCTACCGGCTATGTTGACCGTGCCCAAGATCGAAGGAGTGAC
GAGGCCGACGACCGGCACGAGCGGCTCAAGGCTCTCGAGGCATCCTTCAGAAAAGGCGAGATTGATCAAGAAACC
TATGATGAGCAAAGATATGCCATTGCCGGCGGGTCGCTCGACAGCACACATTTGGTCAAGGGCCTCGACTTTAAA
TTACTACAGAGAGTCAAGCGCGGAGAAGACGTTTTTGGCAAGACTGCCGACGATGATGTTGAAGAGGCATTGGAT
GAGTTTGAGAGCAAAGAGGTCAGCACGATTGAGAGAGAAAAGAGGGAAAAAAGGGGAACCTTTTCCACAACCGCT
CCGGAAACAGGTCAACATCGGACACGAAACCAGATTTTGGCCGAGCTGAAGGCATCGCGAACCGCAGCAAAGGCC
AAACAGGAGGCCTCGTCGCTGGGGGACAGATTCAAAAGAATAGGAACAAAACAAAACGTCGAAACGCGAATCGAG
CGCGACGCCAAGGGACGTGAAGTCCTTATAATCGTTGACGAACATGGAAACGAAAAGCGAAAAGTGCGCAAGCTC
AAGTCTGAAGAGGTTGCGGAGCTGTTGATGCCGGATCCCAACGCGAAGCCCTTGGGCATGGAGGTGCCCGAGCAG
TACCGTCCACAGCAAGAAGCCGAGGAGGAAGAGGAGGATCAAGGGTCAGATATATTTGGCGACGTTGGAGACGAC
TACGATCCCCTGGCTGGCATAGAAGCGTCGAGCTCTGACTCGGAGCAAGACGGCGACCATGGTGAGGAATCCACC
AACAAGGACAGGCAGCAAGGACAAGAGGCTTCAGGCTCCGAGTCTGAGGCTGGAGCCATGGCTCCGTCGCCGCAG
CCTGCACGGCGGCGCAACTACTTTGGAGACTCTAAAACAGGCCTATTGTCCCAAGAAACCACCCGAGCACCGTCT
CTATCAGATCCCTCTATTGCAGCAGCCCTCAAAAAGGCGGCAGCCCTCAACCACATGCAAGACAGCGAAGCCACA
GCAAAGGCAAAACAGGACAAGCAAGCCATGGAGGAGCGGCGCCAAAAACTGCTGCAAATGAGCGAGAGAGACAAT
GACGACTTGGACATGGGCTTTGGCACCAGCCGCTTCGAGGATGAAGACGACGCCGACGACACAAGAGTCAAGCTA
TCTGCCTGGGGCTCGGGCAGCCACGAGGAGCGCGGCGGCGGCCAGGGCAAGAGGAAGAGGGGGCCCAAGAAGCGC
AAGGGCGATGCCAATAGCGCTGCCGATGTGCTGCGCGTCATGGAGCAGCGCAAAAGGCCCTAG
Transcript >OphauB2|508
ATGAACAACGAAGATTTCCGCAAGCTGGTTCTCGCCGGGACCAAACAGCCATCCAGCGCCAAAGATGGCCCATCT
TCTTCAGCCACCAAACAGGGTGGCGCTGGCACGCTGGGGTTGCGACAGCGCTCCAGCTTTTCCTTGACACCGCGC
GCGGTCCTCAAGTCCAAGACTGATCTAGCACGAAAACCCGCCGAGTCAGATTCGAGCCACCACCCGAGGAAAAAA
TTCAAGACGTCGGATCCCAAAGGCGTCAGCCTGGCTACCGGCTATGTTGACCGTGCCCAAGATCGAAGGAGTGAC
GAGGCCGACGACCGGCACGAGCGGCTCAAGGCTCTCGAGGCATCCTTCAGAAAAGGCGAGATTGATCAAGAAACC
TATGATGAGCAAAGATATGCCATTGCCGGCGGGTCGCTCGACAGCACACATTTGGTCAAGGGCCTCGACTTTAAA
TTACTACAGAGAGTCAAGCGCGGAGAAGACGTTTTTGGCAAGACTGCCGACGATGATGTTGAAGAGGCATTGGAT
GAGTTTGAGAGCAAAGAGGTCAGCACGATTGAGAGAGAAAAGAGGGAAAAAAGGGGAACCTTTTCCACAACCGCT
CCGGAAACAGGTCAACATCGGACACGAAACCAGATTTTGGCCGAGCTGAAGGCATCGCGAACCGCAGCAAAGGCC
AAACAGGAGGCCTCGTCGCTGGGGGACAGATTCAAAAGAATAGGAACAAAACAAAACGTCGAAACGCGAATCGAG
CGCGACGCCAAGGGACGTGAAGTCCTTATAATCGTTGACGAACATGGAAACGAAAAGCGAAAAGTGCGCAAGCTC
AAGTCTGAAGAGGTTGCGGAGCTGTTGATGCCGGATCCCAACGCGAAGCCCTTGGGCATGGAGGTGCCCGAGCAG
TACCGTCCACAGCAAGAAGCCGAGGAGGAAGAGGAGGATCAAGGGTCAGATATATTTGGCGACGTTGGAGACGAC
TACGATCCCCTGGCTGGCATAGAAGCGTCGAGCTCTGACTCGGAGCAAGACGGCGACCATGGTGAGGAATCCACC
AACAAGGACAGGCAGCAAGGACAAGAGGCTTCAGGCTCCGAGTCTGAGGCTGGAGCCATGGCTCCGTCGCCGCAG
CCTGCACGGCGGCGCAACTACTTTGGAGACTCTAAAACAGGCCTATTGTCCCAAGAAACCACCCGAGCACCGTCT
CTATCAGATCCCTCTATTGCAGCAGCCCTCAAAAAGGCGGCAGCCCTCAACCACATGCAAGACAGCGAAGCCACA
GCAAAGGCAAAACAGGACAAGCAAGCCATGGAGGAGCGGCGCCAAAAACTGCTGCAAATGAGCGAGAGAGACAAT
GACGACTTGGACATGGGCTTTGGCACCAGCCGCTTCGAGGATGAAGACGACGCCGACGACACAAGAGTCAAGCTA
TCTGCCTGGGGCTCGGGCAGCCACGAGGAGCGCGGCGGCGGCCAGGGCAAGAGGAAGAGGGGGCCCAAGAAGCGC
AAGGGCGATGCCAATAGCGCTGCCGATGTGCTGCGCGTCATGGAGCAGCGCAAAAGGCCCTAG
Gene >OphauB2|508
ATGAACAACGAAGATTTCCGCAAGCTGGTTCTCGCCGGGACCAAACAGCCATCCAGCGCCAAAGATGGCCCATCT
TCTTCAGCCACCAAACAGGGTGGCGCTGGCACGCTGGGGTTGCGACAGCGCTCCAGCTTTTCCTTGACACCGTTG
GTCGAGTCTTTTCTATCTGGTTCCTATTTTGTAACGCTGCTTACTGACTTTTAGATAGGCGCGCGGTCCTCAAGT
CCAAGACTGATCTAGCACGAAAACCCGCCGAGTCAGATTCGAGCCACCACCCGAGGAAAAAATTCAAGACGTCGG
ATCCCAAAGGCGTCAGCCTGGCTACCGGCTATGTTGACCGTGCCCAAGATCGAAGGAGTGACGAGGCCGACGACC
GGCACGAGCGGCTCAAGGCTCTCGAGGCATCCTTCAGAAAAGGCGAGATTGATCAAGAAACCTATGATGAGCAAA
GATATGCCATTGCCGGCGGGTCGCTCGACAGCACACATTTGGTCAAGGGCCTCGACTTTAAATTACTACAGAGAG
TCAAGCGCGGAGAAGACGTTTTTGGCAAGACTGCCGACGATGATGTTGAAGAGGCATTGGATGAGTTTGAGAGCA
AAGAGGTCAGCACGATTGAGAGAGAAAAGAGGGAAAAAAGGGGAACCTTTTCCACAACCGCTCCGGAAACAGGTC
AACATCGGACACGAAACCAGATTTTGGCCGAGCTGAAGGCATCGCGAACCGCAGCAAAGGCCAAACAGGAGGCCT
CGTCGCTGGGGGACAGATTCAAAAGAATAGGAACAAAACAAAACGTCGAAACGCGAATCGAGCGCGACGCCAAGG
GACGTGAAGTCCTTATAATCGTTGACGAACATGGAAACGAAAAGCGAAAAGTGCGCAAGCTCAAGTCTGAAGAGG
TTGCGGAGCTGTTGATGCCGGATCCCAACGCGAAGCCCTTGGGCATGGAGGTGCCCGAGCAGTACCGTCCACAGC
AAGAAGCCGAGGAGGAAGAGGAGGATCAAGGGTCAGATATATTTGGCGACGTTGGAGACGACTACGATCCCCTGG
CTGGCATAGAAGCGTCGAGCTCTGACTCGGAGCAAGACGGCGACCATGGTGAGGAATCCACCAACAAGGACAGGC
AGCAAGGACAAGAGGCTTCAGGCTCCGAGTCTGAGGCTGGAGCCATGGCTCCGTCGCCGCAGCCTGCACGGCGGC
GCAACTACTTTGGAGACTCTAAAACAGGCCTATTGTCCCAAGAAACCACCCGAGCACCGTCTCTATCAGATCCCT
CTATTGCAGCAGCCCTCAAAAAGGCGGCAGCCCTCAACCACATGCAAGACAGCGAAGCCACAGCAAAGGCAAAAC
AGGACAAGCAAGCCATGGAGGAGCGGCGCCAAAAACTGCTGCAAATGAGCGAGAGAGACAATGACGACTTGGACA
TGGGCTTTGGCACCAGCCGCTTCGAGGATGAAGACGACGCCGACGACACAAGAGTCAAGCTATCTGCCTGGGGCT
CGGGCAGCCACGAGGAGCGCGGCGGCGGCCAGGGCAAGAGGAAGAGGGGGCCCAAGAAGCGCAAGGGCGATGCCA
ATAGCGCTGCCGATGTGCTGCGCGTCATGGAGCAGCGCAAAAGGCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail