Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5079
Gene name
LocationContig_37:124185..125437
Strand+
Gene length (bp)1252
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03987 Autophagy_act_C Autophagocytosis associated protein, active-site domain 3.6E-72 34 340

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q51LD2|ATG3_MAGO7 Autophagy-related protein 3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG3 PE=3 SV=1 1 344 1.0E-179
sp|Q7SDY2|ATG3_NEUCR Autophagy-related protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-3 PE=3 SV=2 1 344 7.0E-163
sp|Q2H427|ATG3_CHAGB Autophagy-related protein 3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG3 PE=3 SV=1 1 344 1.0E-154
sp|A7F172|ATG3_SCLS1 Autophagy-related protein 3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg3 PE=3 SV=1 1 344 4.0E-154
sp|A1DF15|ATG3_NEOFI Autophagy-related protein 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg3 PE=3 SV=1 1 344 3.0E-142
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q51LD2|ATG3_MAGO7 Autophagy-related protein 3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG3 PE=3 SV=1 1 344 1.0E-179
sp|Q7SDY2|ATG3_NEUCR Autophagy-related protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-3 PE=3 SV=2 1 344 7.0E-163
sp|Q2H427|ATG3_CHAGB Autophagy-related protein 3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG3 PE=3 SV=1 1 344 1.0E-154
sp|A7F172|ATG3_SCLS1 Autophagy-related protein 3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg3 PE=3 SV=1 1 344 4.0E-154
sp|A1DF15|ATG3_NEOFI Autophagy-related protein 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg3 PE=3 SV=1 1 344 3.0E-142
sp|Q0U388|ATG3_PHANO Autophagy-related protein 3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG3 PE=3 SV=1 2 344 3.0E-139
sp|Q4WUE5|ATG3_ASPFU Autophagy-related protein 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg3 PE=3 SV=1 1 344 1.0E-138
sp|A1CAN8|ATG3_ASPCL Autophagy-related protein 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg3 PE=3 SV=1 1 344 4.0E-136
sp|A7KAL4|ATG3_PENRW Autophagy-related protein 3 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg3 PE=3 SV=1 1 344 2.0E-135
sp|A6S8P6|ATG3_BOTFB Autophagy-related protein 3 OS=Botryotinia fuckeliana (strain B05.10) GN=atg3 PE=3 SV=1 1 344 4.0E-134
sp|Q2U7R4|ATG3_ASPOR Autophagy-related protein 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg3 PE=3 SV=1 1 344 9.0E-134
sp|C8VDI2|ATG3_EMENI Autophagy-related protein 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg3 PE=3 SV=1 1 344 2.0E-124
sp|A7TK16|ATG3_VANPO Autophagy-related protein 3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG3 PE=3 SV=1 4 342 4.0E-78
sp|A7KAI2|ATG3_PICAN Autophagy-related protein 3 OS=Pichia angusta GN=ATG3 PE=3 SV=1 3 342 4.0E-74
sp|Q5ABQ7|ATG3_CANAL Autophagy-related protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG3 PE=3 SV=1 4 342 2.0E-71
sp|A3LX85|ATG3_PICST Autophagy-related protein 3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG3 PE=3 SV=2 4 342 2.0E-70
sp|A5DN42|ATG3_PICGU Autophagy-related protein 3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG3 PE=3 SV=3 4 342 2.0E-69
sp|Q6C4Q9|ATG3_YARLI Autophagy-related protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG3 PE=3 SV=1 1 343 4.0E-68
sp|Q6BSC4|ATG3_DEBHA Autophagy-related protein 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG3 PE=3 SV=2 4 342 2.0E-67
sp|A6ZS81|ATG3_YEAS7 Autophagy-related protein 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG3 PE=3 SV=1 4 342 1.0E-66
sp|P40344|ATG3_YEAST Autophagy-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG3 PE=1 SV=1 4 342 1.0E-66
sp|A5DVH6|ATG3_LODEL Autophagy-related protein 3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ATG3 PE=3 SV=1 4 342 9.0E-66
sp|Q755K1|ATG3_ASHGO Autophagy-related protein 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG3 PE=3 SV=2 4 342 7.0E-63
sp|Q6FQJ2|ATG3_CANGA Autophagy-related protein 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG3 PE=3 SV=1 4 342 3.0E-62
sp|Q6CL19|ATG3_KLULA Autophagy-related protein 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG3 PE=3 SV=1 4 342 8.0E-61
sp|P0CM34|ATG3_CRYNJ Autophagy-related protein 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG3 PE=3 SV=1 4 341 2.0E-49
sp|P0CM35|ATG3_CRYNB Autophagy-related protein 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG3 PE=3 SV=1 4 341 2.0E-49
sp|Q6GQE7|ATG3_XENLA Ubiquitin-like-conjugating enzyme ATG3 OS=Xenopus laevis GN=atg3 PE=2 SV=1 1 341 5.0E-45
sp|O43035|ATG3_SCHPO Autophagy-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg3 PE=3 SV=1 4 268 8.0E-45
sp|Q5I0S6|ATG3_XENTR Ubiquitin-like-conjugating enzyme ATG3 OS=Xenopus tropicalis GN=atg3 PE=2 SV=1 4 341 2.0E-44
sp|Q0VCL3|ATG3_BOVIN Ubiquitin-like-conjugating enzyme ATG3 OS=Bos taurus GN=ATG3 PE=2 SV=1 1 251 2.0E-44
sp|Q0WWQ1|ATG3_ARATH Autophagy-related protein 3 OS=Arabidopsis thaliana GN=ATG3 PE=1 SV=2 13 251 3.0E-44
sp|Q9NT62|ATG3_HUMAN Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens GN=ATG3 PE=1 SV=1 1 251 4.0E-43
sp|Q9CPX6|ATG3_MOUSE Ubiquitin-like-conjugating enzyme ATG3 OS=Mus musculus GN=Atg3 PE=1 SV=1 1 251 1.0E-42
sp|Q6PFS7|ATG3_DANRE Ubiquitin-like-conjugating enzyme ATG3 OS=Danio rerio GN=atg3 PE=2 SV=1 1 341 2.0E-42
sp|Q6AZ50|ATG3_RAT Ubiquitin-like-conjugating enzyme ATG3 OS=Rattus norvegicus GN=Atg3 PE=2 SV=1 1 251 2.0E-41
sp|Q550A8|ATG3_DICDI Autophagy-related protein 3 OS=Dictyostelium discoideum GN=atg3 PE=3 SV=3 154 252 2.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0019787 ubiquitin-like protein transferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5079
MNYLKSTVNTLRDRYTPVSHTSTFRQTGQITPSEFVAAGDYLVYKFPTWSWADADDESRRVSHLPPGKQFLVTRN
VPCHRRLDQDFAGDAGHEEAVVRGGDDFKDDDGWLRTGGLVSSQPLKARDVRTVDDLGNIVDTADPDDDDDIPDM
EDEEDDDAIIRDVAADSRNSGRRTYTLYIMYTPYYRTPRLYLSGYLPNGQPLPPQSMMDDIVGDYKDKTVTLEDF
PFFANNIKMASVHPCKHASVMKTLLDRADAALRIRRDKLRAGQAAGSVSGMEGLVTGLGKLDMEGTSHESVDKDE
WEQVEGVEADEQDVAIRVDQYLVVFLKFMASVTPGIEHDFTMGV*
Coding >OphauB2|5079
ATGAACTACCTCAAGTCGACCGTCAACACGCTTCGCGACAGATACACGCCCGTATCTCACACGTCAACATTTCGG
CAGACGGGTCAGATTACACCGAGCGAGTTCGTGGCAGCGGGCGACTATCTTGTCTACAAGTTTCCTACATGGTCG
TGGGCAGACGCCGACGATGAGAGCCGCCGAGTCAGCCATCTCCCGCCAGGCAAGCAGTTTCTAGTCACGCGCAAC
GTACCATGTCATCGCCGCCTTGACCAAGATTTTGCGGGCGATGCTGGGCACGAGGAGGCAGTCGTGCGTGGTGGC
GACGACTTCAAAGACGACGATGGTTGGCTACGGACGGGCGGACTGGTTAGTTCCCAGCCGCTCAAGGCACGCGAT
GTTCGCACTGTCGACGACTTGGGCAATATTGTCGACACGGCCGACCCTGATGACGATGATGATATTCCTGACATG
GAGGACGAAGAAGATGACGACGCGATTATTAGAGATGTCGCCGCTGATTCGCGAAATAGTGGACGCCGGACGTAC
ACTCTCTACATCATGTACACGCCTTATTATCGTACACCTCGGCTATATCTCTCTGGATACCTGCCAAACGGACAA
CCGCTGCCACCACAGAGTATGATGGACGACATTGTGGGCGACTACAAGGACAAGACAGTGACGCTCGAGGACTTT
CCATTCTTTGCCAACAACATCAAGATGGCAAGTGTGCATCCTTGCAAACACGCCTCCGTCATGAAGACGCTTCTC
GACCGCGCCGATGCTGCGCTACGCATTCGTCGTGATAAGCTGCGCGCCGGCCAGGCTGCTGGCAGTGTCTCTGGT
ATGGAGGGGCTTGTCACAGGGCTTGGCAAGCTCGACATGGAAGGCACCAGTCATGAGTCTGTTGATAAAGACGAG
TGGGAGCAGGTCGAGGGTGTCGAGGCCGACGAACAGGATGTGGCCATTCGGGTCGACCAGTATCTCGTCGTCTTC
CTCAAGTTCATGGCTAGTGTTACGCCTGGCATCGAACACGACTTCACCATGGGTGTTTGA
Transcript >OphauB2|5079
ATGAACTACCTCAAGTCGACCGTCAACACGCTTCGCGACAGATACACGCCCGTATCTCACACGTCAACATTTCGG
CAGACGGGTCAGATTACACCGAGCGAGTTCGTGGCAGCGGGCGACTATCTTGTCTACAAGTTTCCTACATGGTCG
TGGGCAGACGCCGACGATGAGAGCCGCCGAGTCAGCCATCTCCCGCCAGGCAAGCAGTTTCTAGTCACGCGCAAC
GTACCATGTCATCGCCGCCTTGACCAAGATTTTGCGGGCGATGCTGGGCACGAGGAGGCAGTCGTGCGTGGTGGC
GACGACTTCAAAGACGACGATGGTTGGCTACGGACGGGCGGACTGGTTAGTTCCCAGCCGCTCAAGGCACGCGAT
GTTCGCACTGTCGACGACTTGGGCAATATTGTCGACACGGCCGACCCTGATGACGATGATGATATTCCTGACATG
GAGGACGAAGAAGATGACGACGCGATTATTAGAGATGTCGCCGCTGATTCGCGAAATAGTGGACGCCGGACGTAC
ACTCTCTACATCATGTACACGCCTTATTATCGTACACCTCGGCTATATCTCTCTGGATACCTGCCAAACGGACAA
CCGCTGCCACCACAGAGTATGATGGACGACATTGTGGGCGACTACAAGGACAAGACAGTGACGCTCGAGGACTTT
CCATTCTTTGCCAACAACATCAAGATGGCAAGTGTGCATCCTTGCAAACACGCCTCCGTCATGAAGACGCTTCTC
GACCGCGCCGATGCTGCGCTACGCATTCGTCGTGATAAGCTGCGCGCCGGCCAGGCTGCTGGCAGTGTCTCTGGT
ATGGAGGGGCTTGTCACAGGGCTTGGCAAGCTCGACATGGAAGGCACCAGTCATGAGTCTGTTGATAAAGACGAG
TGGGAGCAGGTCGAGGGTGTCGAGGCCGACGAACAGGATGTGGCCATTCGGGTCGACCAGTATCTCGTCGTCTTC
CTCAAGTTCATGGCTAGTGTTACGCCTGGCATCGAACACGACTTCACCATGGGTGTTTGA
Gene >OphauB2|5079
ATGAACTACCTCAAGTCGACCGTCAACACGCTTCGCGACAGATACACGCCCGTATCTCACACGTCAACATTTCGG
CAGACGGGTCAGATTACACCGAGCGAGTTCGTGGCAGCGGGCGACTATCTTGTCTACAAGTTTCCTACATGGTCG
TGGGCAGACGCCGACGATGAGAGCCGCCGAGTCAGCCATCTCCCGCCAGGCAAGCAGTTTCTAGTCACGCGCAAC
GTACCATGTCATCGCCGCCTTGACCAAGATTTTGCGGGCGATGCTGGGCACGAGGAGGCAGTCGTGCGTGGTGGC
GACGACTTCAAAGACGACGATGGTTGGCTACGGACGGGCGGACTGGTTAGTTCCCAGCCGCTCAAGGCACGCGAT
GTTCGCACTGTCGACGACTTGGGCAATATTGTCGACACGGCCGACCCTGATGACGATGATGATATTCCTGACATG
GAGGACGAAGAAGATGACGACGCGATTATTAGAGATGTCGCCGCTGATTCGCGAAATAGGCAAGTTGGCCCAGTG
GTCCAGCTTGAATCATGGCTCCTCTTGTAAAGACGACATTGGTCTCTTGCCGAATGAACTAACAACTCTACCAAT
AGTGGACGCCGGACGTACACTCTCTACATCATGTACACGCCTTATTATCGTACACCTCGGCTATATCTCTCTGGA
TACCTGCCAAACGGACAACCGCTGCCACCACAGAGTATGATGGACGACATTGTGGGCGACTACAAGGACAAGACA
GTGACGCTCGAGGACTTTCCATTCTTTGCCAACAACATCAAGATGGCAAGTGTGCATCCTTGCAAACACGCCTCC
GTCATGAAGACGCTTCTCGACCGCGCCGATGCTGCGCTACGCATTCGTCGTGATAAGCTGCGCGCCGGCCAGGCT
GCTGGCAGTGTCTCTGGTATGGAGGGGCTTGTCACAGGGCTTGGCAAGCTCGACATGGAAGGCACCAGTCATGAG
TCTGTTGATAAAGACGAGTGGGAGCAGGTCGAGGGTGTCGAGGCCGACGAACAGGATGTGGCCATTCGGGTCGAC
CAGTATCTCGTCGTCTTCCTCAAGGTATGTATTTTTTTGCCACTGTCATGGGATGTGGTTCAAAGTATTTTTTAT
TTCGACCACTACTCCAACCCTCGTCATCATGGTTGGCGACATGTCGTGCTAATCAATGTTGCTTTGCCACTAGTT
CATGGCTAGTGTTACGCCTGGCATCGAACACGACTTCACCATGGGTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail