Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5078
Gene name
LocationContig_37:122730..123556
Strand+
Gene length (bp)826
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 6.3E-09 89 112
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 1.4E-07 166 205
PF13445 zf-RING_UBOX RING-type zinc-finger 2.2E-07 167 201
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 3.5E-07 167 204
PF14634 zf-RING_5 zinc-RING finger domain 5.0E-07 167 205
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 7.3E-07 167 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WUA0|CWC24_ASPFU Pre-mRNA-splicing factor cwc24 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc24 PE=3 SV=1 13 250 2.0E-93
sp|Q7SDY3|CWC24_NEUCR Pre-mRNA-splicing factor cwc-24 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-24 PE=3 SV=1 4 226 6.0E-92
sp|Q5AVC5|CWC24_EMENI Pre-mRNA-splicing factor cwc24 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc24 PE=3 SV=1 7 222 2.0E-81
sp|Q4P400|CWC24_USTMA Pre-mRNA-splicing factor CWC24 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC24 PE=3 SV=1 19 235 1.0E-51
sp|Q9P6R8|CWC24_SCHPO Pre-mRNA-splicing factor cwf24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf24 PE=1 SV=1 66 228 1.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WUA0|CWC24_ASPFU Pre-mRNA-splicing factor cwc24 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc24 PE=3 SV=1 13 250 2.0E-93
sp|Q7SDY3|CWC24_NEUCR Pre-mRNA-splicing factor cwc-24 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-24 PE=3 SV=1 4 226 6.0E-92
sp|Q5AVC5|CWC24_EMENI Pre-mRNA-splicing factor cwc24 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc24 PE=3 SV=1 7 222 2.0E-81
sp|Q4P400|CWC24_USTMA Pre-mRNA-splicing factor CWC24 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC24 PE=3 SV=1 19 235 1.0E-51
sp|Q9P6R8|CWC24_SCHPO Pre-mRNA-splicing factor cwf24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf24 PE=1 SV=1 66 228 1.0E-50
sp|O15541|R113A_HUMAN RING finger protein 113A OS=Homo sapiens GN=RNF113A PE=1 SV=1 49 226 3.0E-47
sp|Q67ER4|R113A_BOVIN RING finger protein 113A OS=Bos taurus GN=RNF113A PE=2 SV=1 49 226 6.0E-46
sp|Q8GX84|C3H1_ARATH Zinc finger CCCH domain-containing protein 1 OS=Arabidopsis thaliana GN=At1g01350 PE=2 SV=2 60 229 1.0E-44
sp|Q9FNG6|C3H51_ARATH Zinc finger CCCH domain-containing protein 51 OS=Arabidopsis thaliana GN=At5g06420 PE=2 SV=1 60 229 3.0E-44
sp|Q752S4|CWC24_ASHGO Pre-mRNA-splicing factor CWC24 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CWC24 PE=3 SV=1 62 223 1.0E-43
sp|Q8IZP6|R113B_HUMAN RING finger protein 113B OS=Homo sapiens GN=RNF113B PE=1 SV=3 55 224 3.0E-43
sp|P53769|CWC24_YEAST Pre-mRNA-splicing factor CWC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWC24 PE=1 SV=1 62 226 4.0E-43
sp|P0CQ64|CWC24_CRYNJ Pre-mRNA-splicing factor CWC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC24 PE=3 SV=1 55 218 1.0E-42
sp|P0CQ65|CWC24_CRYNB Pre-mRNA-splicing factor CWC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC24 PE=3 SV=1 55 218 1.0E-42
sp|Q6CB23|CWC24_YARLI Pre-mRNA-splicing factor CWC24 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC24 PE=3 SV=1 6 217 2.0E-42
sp|Q6FXX1|CWC24_CANGA Pre-mRNA-splicing factor CWC24 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CWC24 PE=3 SV=1 49 218 9.0E-40
sp|O17917|RN113_CAEEL RING finger protein 113 homolog OS=Caenorhabditis elegans GN=rnf-113 PE=2 SV=2 69 224 5.0E-38
sp|Q6K4V3|C3H15_ORYSJ Zinc finger CCCH domain-containing protein 15 OS=Oryza sativa subsp. japonica GN=Os02g0301000 PE=2 SV=1 60 228 2.0E-37
sp|Q6CSS6|CWC24_KLULA Pre-mRNA-splicing factor CWC24 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CWC24 PE=3 SV=1 61 224 3.0E-35
sp|Q6BYU0|CWC24_DEBHA Pre-mRNA-splicing factor CWC24 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC24 PE=3 SV=2 68 223 1.0E-34
sp|Q55G16|RN113_DICDI RING finger protein 113 homolog OS=Dictyostelium discoideum GN=rnf113 PE=3 SV=1 56 222 2.0E-34
sp|Q5ACW2|CWC24_CANAL Pre-mRNA-splicing factor CWC24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC24 PE=3 SV=1 5 212 1.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5078
MTATVHTANRDTPITTTNDATKQSNWYEQDDQVSTAAGYLLGSTRQVAKNTQPHGTYKGLASAKPKTTVGPIQAP
TNVRTITVTDFAPDVCKDYKQTGFCGFGDNCKFLHSREDYKQGWQLDREWENVSKGRHKMGGTVVASARRDKPKD
DDDDDEEAMLDNIPFVCIICRESYKEPIVTRCGHYFCEACALKRYRRDPTCAACGVGTNGVFNTAKRLKRLLTRK
RERAAIRRKEAIEAGEEVSDGDEETHDK*
Coding >OphauB2|5078
ATGACAGCAACCGTCCATACCGCCAACCGAGACACACCAATTACCACCACAAACGATGCGACCAAGCAGAGCAAT
TGGTACGAACAAGATGATCAAGTTTCCACGGCAGCTGGCTACCTGCTTGGCTCGACTCGACAAGTTGCAAAAAAC
ACGCAGCCCCATGGCACATACAAGGGTCTTGCCAGTGCAAAACCCAAGACGACAGTTGGGCCAATCCAGGCGCCT
ACCAACGTGCGGACAATCACTGTAACTGACTTTGCCCCGGATGTCTGCAAAGACTACAAGCAGACGGGGTTTTGC
GGCTTCGGTGATAATTGCAAATTTCTCCATAGTAGAGAAGACTATAAACAGGGTTGGCAACTCGATCGAGAATGG
GAAAATGTGTCAAAGGGTAGGCACAAGATGGGTGGCACTGTTGTGGCCAGTGCACGGCGGGACAAGCCCAAGGAC
GACGACGACGACGATGAAGAGGCCATGCTAGATAACATTCCTTTTGTCTGCATCATCTGCCGGGAGTCGTACAAG
GAGCCGATAGTGACGAGGTGCGGGCACTACTTTTGCGAGGCGTGCGCCCTCAAGAGATACAGGCGAGACCCGACT
TGCGCCGCATGTGGCGTGGGCACCAACGGCGTCTTCAACACAGCCAAAAGACTAAAGAGGCTTTTGACCCGCAAG
AGAGAGAGGGCTGCTATTCGTAGAAAGGAGGCAATTGAAGCTGGCGAGGAAGTCAGTGACGGCGATGAAGAAACA
CACGACAAGTAA
Transcript >OphauB2|5078
ATGACAGCAACCGTCCATACCGCCAACCGAGACACACCAATTACCACCACAAACGATGCGACCAAGCAGAGCAAT
TGGTACGAACAAGATGATCAAGTTTCCACGGCAGCTGGCTACCTGCTTGGCTCGACTCGACAAGTTGCAAAAAAC
ACGCAGCCCCATGGCACATACAAGGGTCTTGCCAGTGCAAAACCCAAGACGACAGTTGGGCCAATCCAGGCGCCT
ACCAACGTGCGGACAATCACTGTAACTGACTTTGCCCCGGATGTCTGCAAAGACTACAAGCAGACGGGGTTTTGC
GGCTTCGGTGATAATTGCAAATTTCTCCATAGTAGAGAAGACTATAAACAGGGTTGGCAACTCGATCGAGAATGG
GAAAATGTGTCAAAGGGTAGGCACAAGATGGGTGGCACTGTTGTGGCCAGTGCACGGCGGGACAAGCCCAAGGAC
GACGACGACGACGATGAAGAGGCCATGCTAGATAACATTCCTTTTGTCTGCATCATCTGCCGGGAGTCGTACAAG
GAGCCGATAGTGACGAGGTGCGGGCACTACTTTTGCGAGGCGTGCGCCCTCAAGAGATACAGGCGAGACCCGACT
TGCGCCGCATGTGGCGTGGGCACCAACGGCGTCTTCAACACAGCCAAAAGACTAAAGAGGCTTTTGACCCGCAAG
AGAGAGAGGGCTGCTATTCGTAGAAAGGAGGCAATTGAAGCTGGCGAGGAAGTCAGTGACGGCGATGAAGAAACA
CACGACAAGTAA
Gene >OphauB2|5078
ATGACAGCAACCGTCCATACCGCCAACCGAGACACACCAATTACCACCACAAACGATGCGACCAAGCAGAGCAAT
TGGTACGAACAAGATGATCAAGTTTCCACGGCAGCTGGCTACCTGCTTGGCTCGACTCGACAAGTTGCAAAAAAC
ACGCAGCCCCATGGCACATACAAGGGTCTTGCCAGTGCAAAACCCAAGACGACAGTTGGGCCAATCCAGGCGCCT
ACCAACGTGCGGACAATCACTGTAACTGACTTTGCCCCGGATGTCTGCAAAGACTACAAGCAGACGGGGTTTTGC
GGCTTCGGTGATAATTGGCAAGTGCTCTCTCTATTTAATCGCTGTCTTCATCGCAGTTGCTAACCATGGCGTTCT
GTGCAGCAAATTTCTCCATAGTAGAGAAGACTATAAACAGGGTTGGCAACTCGATCGAGAATGGGAAAATGTGTC
AAAGGGTAGGCACAAGATGGGTGGCACTGTTGTGGCCAGTGCACGGCGGGACAAGCCCAAGGACGACGACGACGA
CGATGAAGAGGCCATGCTAGATAACATTCCTTTTGTCTGCATCATCTGCCGGGAGTCGTACAAGGAGCCGATAGT
GACGAGGTGCGGGCACTACTTTTGCGAGGCGTGCGCCCTCAAGAGATACAGGCGAGACCCGACTTGCGCCGCATG
TGGCGTGGGCACCAACGGCGTCTTCAACACAGCCAAAAGACTAAAGAGGCTTTTGACCCGCAAGAGAGAGAGGGC
TGCTATTCGTAGAAAGGAGGCAATTGAAGCTGGCGAGGAAGTCAGTGACGGCGATGAAGAAACACACGACAAGTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail