Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5075
Gene name
LocationContig_37:107447..110157
Strand-
Gene length (bp)2710
Transcript length (bp)2055
Coding sequence length (bp)2055
Protein length (aa) 685

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.0E-07 143 209
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.3E-11 328 400

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38741|RIM4_YEAST Meiotic activator RIM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM4 PE=1 SV=1 139 310 1.0E-12
sp|Q10277|MSA1_SCHPO Multicopy suppressor of sporulation protein msa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msa1 PE=3 SV=1 140 250 6.0E-08

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5075
MAPSSHKSDKTSSMAEGLVYPSVRKAASSEPLFYKGSLAASDDGSVHGGAECQTASDTLSPDTKHSSRPKKPVSI
ADTPISTRSSNFMVGSSEDDDVFTDFSTSINDIHKASAFGGRTQLAVYQDSRDKVDPQTMYAGSSCMFVANLPQQ
FSDRKLEEEVTKVFSQFGIVFVKIKRDGRGMPFAFCQYTNDLDAEKAMTMGKGTVILERPCRTEMARAQSSFIVY
KISGQRIRLSEARDLLHRLGDVAKVEYLHEGLRISASLPQTAVVTFKMYDAKRDPPRVFANDPTFCVKIYDPKSL
SAPENLTVPKPQEGSFLRQYDRDRRSAYVGNLPPGMTKDLLCSLASSCGEVLEAQLHHKEVLGGHGLKTCFGFLE
FSRPDAPDELITAMNNTEIDGYRIRVERKQSRLAEAPHHTTATCGGSPNTRPPASRPRVGSVELEKSLGGRFGTT
PMGSIGMTTHRKQYASTSYTPGRNRSSRPTILDSTPSPYYDLFEPPHTAYTASPEGTAMTSADNSYLSPSDKKSV
DFDLRHMPGTFTGSSGAAFRDKNHRPSTPMSPVMSATSSEKKKSASVRSELSIIPPPTVPWMASYPPYGYPYMGA
PMTPQGNAAMMYAGYMQPHVYHPMFDMYGNMMIPPTPMVPPFAGPNFLNDTPARSERGESVLGDESKQSPSKSEK
KVNFNHSTL*
Coding >OphauB2|5075
ATGGCTCCAAGCTCACACAAGTCGGACAAGACAAGCTCCATGGCAGAGGGTCTCGTTTATCCCTCTGTCCGTAAA
GCTGCTTCAAGTGAGCCACTCTTCTACAAAGGTTCTTTGGCGGCTTCAGATGATGGCAGTGTCCATGGCGGTGCT
GAATGCCAGACGGCTAGTGATACTTTGTCGCCTGACACTAAGCATTCGTCTCGCCCCAAGAAACCAGTGTCCATT
GCTGATACCCCAATCTCTACTCGCTCTTCCAATTTCATGGTTGGCTCTAGTGAAGACGACGATGTTTTCACTGAC
TTTTCGACTTCTATCAACGACATTCATAAAGCCTCTGCCTTTGGTGGTCGCACGCAGCTTGCTGTCTATCAGGAC
TCGCGCGACAAGGTTGATCCCCAGACAATGTATGCCGGGTCCTCGTGCATGTTCGTCGCCAATCTCCCACAGCAA
TTCAGTGATCGCAAGTTGGAGGAAGAAGTGACCAAAGTGTTCAGTCAATTTGGTATTGTCTTTGTCAAGATCAAG
CGCGACGGTCGAGGCATGCCTTTTGCCTTTTGCCAGTACACGAACGATCTCGACGCCGAAAAGGCCATGACAATG
GGAAAGGGAACTGTAATCCTTGAGCGACCTTGCCGCACTGAGATGGCCAGAGCACAGTCTTCATTTATAGTCTAC
AAAATTTCGGGTCAGCGGATTCGACTCAGCGAAGCACGAGACCTTCTACACCGTCTTGGAGATGTTGCAAAAGTA
GAATATCTACATGAGGGTCTACGTATCTCGGCAAGTCTTCCGCAGACGGCTGTTGTCACGTTCAAGATGTATGAC
GCGAAACGTGATCCGCCAAGGGTTTTTGCAAACGACCCTACCTTTTGTGTCAAGATCTACGATCCCAAATCTTTG
TCTGCCCCAGAGAACTTGACTGTCCCCAAGCCACAGGAGGGAAGCTTCCTTCGACAATATGACAGGGACAGGAGA
TCGGCGTATGTTGGAAATCTACCACCAGGTATGACCAAGGATCTCTTGTGCTCGCTTGCCAGTTCGTGTGGCGAG
GTTTTGGAGGCACAGCTCCATCACAAAGAAGTTTTGGGCGGACACGGACTCAAAACGTGTTTCGGCTTCCTTGAG
TTCAGCCGACCAGATGCTCCCGACGAGCTCATTACGGCAATGAATAACACCGAGATTGACGGTTATCGAATTCGA
GTTGAGCGTAAGCAGTCGCGACTGGCTGAGGCTCCACATCACACCACGGCGACATGTGGCGGCTCGCCCAATACT
CGGCCTCCAGCGAGTCGTCCGCGCGTTGGCTCGGTTGAGCTTGAGAAGTCCTTGGGAGGACGTTTCGGCACGACT
CCCATGGGAAGCATTGGCATGACTACTCATCGCAAACAATATGCTTCGACGTCGTATACTCCAGGCCGCAATCGC
TCCTCGCGTCCAACGATTCTCGACTCTACTCCTTCTCCTTACTACGATCTGTTTGAGCCTCCACACACCGCTTAT
ACAGCCTCTCCCGAGGGCACCGCGATGACCTCTGCCGACAACTCATACTTGTCTCCGTCGGACAAGAAGTCTGTC
GATTTTGATCTACGCCATATGCCTGGCACTTTTACTGGCTCGAGCGGTGCAGCATTCCGCGACAAGAATCATAGG
CCATCAACTCCAATGAGTCCAGTCATGTCCGCCACATCGTCGGAGAAGAAGAAGTCTGCTTCAGTTCGCAGTGAG
CTTTCTATTATTCCTCCTCCAACGGTGCCTTGGATGGCGTCTTATCCGCCCTATGGATATCCGTACATGGGGGCC
CCAATGACGCCTCAAGGCAATGCTGCCATGATGTATGCTGGCTATATGCAGCCTCATGTCTACCATCCCATGTTT
GACATGTACGGCAATATGATGATTCCGCCAACCCCCATGGTACCACCTTTCGCTGGGCCGAATTTTCTCAACGAT
ACTCCGGCACGATCTGAGCGAGGCGAGTCGGTTTTGGGCGACGAATCGAAACAATCGCCCAGCAAGAGTGAGAAG
AAAGTCAACTTCAACCATTCAACTCTTTAA
Transcript >OphauB2|5075
ATGGCTCCAAGCTCACACAAGTCGGACAAGACAAGCTCCATGGCAGAGGGTCTCGTTTATCCCTCTGTCCGTAAA
GCTGCTTCAAGTGAGCCACTCTTCTACAAAGGTTCTTTGGCGGCTTCAGATGATGGCAGTGTCCATGGCGGTGCT
GAATGCCAGACGGCTAGTGATACTTTGTCGCCTGACACTAAGCATTCGTCTCGCCCCAAGAAACCAGTGTCCATT
GCTGATACCCCAATCTCTACTCGCTCTTCCAATTTCATGGTTGGCTCTAGTGAAGACGACGATGTTTTCACTGAC
TTTTCGACTTCTATCAACGACATTCATAAAGCCTCTGCCTTTGGTGGTCGCACGCAGCTTGCTGTCTATCAGGAC
TCGCGCGACAAGGTTGATCCCCAGACAATGTATGCCGGGTCCTCGTGCATGTTCGTCGCCAATCTCCCACAGCAA
TTCAGTGATCGCAAGTTGGAGGAAGAAGTGACCAAAGTGTTCAGTCAATTTGGTATTGTCTTTGTCAAGATCAAG
CGCGACGGTCGAGGCATGCCTTTTGCCTTTTGCCAGTACACGAACGATCTCGACGCCGAAAAGGCCATGACAATG
GGAAAGGGAACTGTAATCCTTGAGCGACCTTGCCGCACTGAGATGGCCAGAGCACAGTCTTCATTTATAGTCTAC
AAAATTTCGGGTCAGCGGATTCGACTCAGCGAAGCACGAGACCTTCTACACCGTCTTGGAGATGTTGCAAAAGTA
GAATATCTACATGAGGGTCTACGTATCTCGGCAAGTCTTCCGCAGACGGCTGTTGTCACGTTCAAGATGTATGAC
GCGAAACGTGATCCGCCAAGGGTTTTTGCAAACGACCCTACCTTTTGTGTCAAGATCTACGATCCCAAATCTTTG
TCTGCCCCAGAGAACTTGACTGTCCCCAAGCCACAGGAGGGAAGCTTCCTTCGACAATATGACAGGGACAGGAGA
TCGGCGTATGTTGGAAATCTACCACCAGGTATGACCAAGGATCTCTTGTGCTCGCTTGCCAGTTCGTGTGGCGAG
GTTTTGGAGGCACAGCTCCATCACAAAGAAGTTTTGGGCGGACACGGACTCAAAACGTGTTTCGGCTTCCTTGAG
TTCAGCCGACCAGATGCTCCCGACGAGCTCATTACGGCAATGAATAACACCGAGATTGACGGTTATCGAATTCGA
GTTGAGCGTAAGCAGTCGCGACTGGCTGAGGCTCCACATCACACCACGGCGACATGTGGCGGCTCGCCCAATACT
CGGCCTCCAGCGAGTCGTCCGCGCGTTGGCTCGGTTGAGCTTGAGAAGTCCTTGGGAGGACGTTTCGGCACGACT
CCCATGGGAAGCATTGGCATGACTACTCATCGCAAACAATATGCTTCGACGTCGTATACTCCAGGCCGCAATCGC
TCCTCGCGTCCAACGATTCTCGACTCTACTCCTTCTCCTTACTACGATCTGTTTGAGCCTCCACACACCGCTTAT
ACAGCCTCTCCCGAGGGCACCGCGATGACCTCTGCCGACAACTCATACTTGTCTCCGTCGGACAAGAAGTCTGTC
GATTTTGATCTACGCCATATGCCTGGCACTTTTACTGGCTCGAGCGGTGCAGCATTCCGCGACAAGAATCATAGG
CCATCAACTCCAATGAGTCCAGTCATGTCCGCCACATCGTCGGAGAAGAAGAAGTCTGCTTCAGTTCGCAGTGAG
CTTTCTATTATTCCTCCTCCAACGGTGCCTTGGATGGCGTCTTATCCGCCCTATGGATATCCGTACATGGGGGCC
CCAATGACGCCTCAAGGCAATGCTGCCATGATGTATGCTGGCTATATGCAGCCTCATGTCTACCATCCCATGTTT
GACATGTACGGCAATATGATGATTCCGCCAACCCCCATGGTACCACCTTTCGCTGGGCCGAATTTTCTCAACGAT
ACTCCGGCACGATCTGAGCGAGGCGAGTCGGTTTTGGGCGACGAATCGAAACAATCGCCCAGCAAGAGTGAGAAG
AAAGTCAACTTCAACCATTCAACTCTTTAA
Gene >OphauB2|5075
ATGGCTCCAAGCTCACACAAGTCGGACAAGACAAGCTCCATGGCAGAGGGTCTCGTTTATCCCTCTGTCCGTAAA
GCTGCTTCAAGTGAGCCACTCTTCTACAAAGGTTCTTTGGCGGCTTCAGATGATGGCAGTGTCCATGGCGGTGAG
TTTCTGACCTTATCTGGGGGGACCCATGCCCACAATCTTCTGCAGTTCATGTTCTTTACCTAAACCTAGCCATTT
CACGATTCAAGGCCTATTGATGGCTACTTTTGTAGCAAGCTGACGCTTCATTCCTAGGTGCTGAATGCCAGACGG
CTAGTGATACTTTGTCGCCTGACACTAAGCATTCGTGGGTTATCCTCTTCTCTCGGACCTCTGAAAAGGAGCCCA
AAGCTGACGCTAAACCAAGGTCTCGCCCCAAGAAACCAGTGTCCATTGCTGATACCCCAATCTCTACTCGGTATG
GCCTTGCTTCCTCTTGTTGTATAACAACATCGCTCATTGAAACCAAAAGCTCTTCCAATTTCATGGTTGGCTCTA
GTGAAGACGACGATGTTTTCACTGACTTTTCGACTTCTATCAACGACATTCATAAAGCCTCTGCCTTTGGTGGTC
GCACGCAGCTTGCTGTCTATCAGGACTCGCGCGACAAGGTTGATCCCCAGACAATGTATGCCGGGTCCTCGTGCA
TGTTCGTCGCCAAGTAGGTTTTTGCAATCACTTGAAACTATATCCGCCTACTTTGGATCAATGCTAATTTCTTGC
AGTCTCCCACAGCAATTCAGTGATCGCAAGTTGGAGGAAGAAGTGACCAAAGTGTTCAGTCAATTTGGTATTGTC
TTTGTCAAGATCAAGCGCGACGGTCGAGGCATGCCTTTTGCCTTTTGCCAGTACACGGTGAGCCACTTGCACAAG
CTTTTTTTTTTCCTTTCTTTTTTTTATGTGTATAATATCTATGTTTGAGACCACTACTGACTCTTCTTAGAACGA
TCTCGACGCCGAAAAGGCCATGACAATGGGAAAGGGAACTGTAATCCTTGAGCGACCTTGCCGCACTGAGATGGC
CAGAGCACAGTGTTGGTTCAGCAGTCAAACTTGTCAAGGGGGAAAACATCACTAACTAAAGAGTTCAGCTTCATT
TATAGTCTACAAAATTTCGGGTCAGCGGATTCGACTCAGCGAAGCACGAGACCTTCTACACCGTCTTGGAGATGT
TGCAAAAGTAGAATATCTACATGAGGGTCTACGTATCTCGGCAAGTCTTCCGCAGACGGCTGTTGTCACGTTCAA
GATGTATGACGCGAAACGTGATCCGCCAAGGGCAAGTCAATTCTCTACCCGTCTGTCATTGGCTCTCTAACTAAC
AATCGATTTGGCCAGGTTTTTGCAAACGACCCTACCTTTTGTGTCAAGATCTACGATCCCAAATCTTTGTCTGCC
CCAGAGAACTTGACTGTCCCCAAGCCACAGGAGGGAAGCTTCCTTCGACAATATGACAGGGACAGGAGATCGGCG
TATGTTGGAAATCTACCACCAGGTATGACCAAGGATCTCTTGTGCTCGCTTGCCAGTTCGTGTGGCGAGGTTTTG
GAGGCACAGCTCCATCACAAAGAAGTTTTGGGCGGACACGGTAAGTCTTGATACGTCTAGCAATTTGAAGTCACA
TTTTTGACAGGTTTGTTTTAGGACTCAAAACGTGTTTCGGCTTCCTTGAGTTCAGCCGACCAGATGCTCCCGACG
AGCTCATTACGGCAATGGTTAGTCCAAGTCTGCGCGCGCCTTGACTCTTTTTCCGCTGCTTCAAGTGAACTTGCT
CAAGCTGATTTGGTGAGAGTAGAATAACACCGAGATTGACGGTTATCGAATTCGAGTTGAGCGTAAGCAGTCGCG
ACTGGCTGAGGCTCCACATCACACCACGGCGACATGTGGCGGCTCGCCCAATACTCGGCCTCCAGCGAGTCGTCC
GCGCGTTGGCTCGGTTGAGCTTGAGAAGTCCTTGGGAGGACGTTTCGGCACGACTCCCATGGGAAGCATTGGCAT
GACTACTCATCGCAAACAATATGCTTCGACGTCGTATACTCCAGGCCGCAATCGCTCCTCGCGTCCAACGATTCT
CGACTCTACTCCTTCTCCTTACTACGATCTGTTTGAGCCTCCACACACCGCTTATACAGCCTCTCCCGAGGGCAC
CGCGATGACCTCTGCCGACAACTCATACTTGTCTCCGTCGGACAAGAAGTCTGTCGATTTTGATCTACGCCATAT
GCCTGGCACTTTTACTGGCTCGAGCGGTGCAGCATTCCGCGACAAGAATCATAGGCCATCAACTCCAATGAGTCC
AGTCATGTCCGCCACATCGTCGGAGAAGAAGAAGTCTGCTTCAGTTCGCAGTGAGCTTTCTATTATTCCTCCTCC
AACGGTGCCTTGGATGGCGTCTTATCCGCCCTATGGATATCCGTACATGGGGGCCCCAATGACGCCTCAAGGCAA
TGCTGCCATGATGTATGCTGGCTATATGCAGCCTCATGTCTACCATCCCATGTTTGACATGTACGGCAATATGAT
GATTCCGCCAACCCCCATGGTACCACCTTTCGCTGGGCCGAATTTTCTCAACGATACTCCGGCACGATCTGAGCG
AGGCGAGTCGGTTTTGGGCGACGAATCGAAACAATCGCCCAGCAAGAGTGAGAAGAAAGTCAACTTCAACCATTC
AACTCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail