Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5074
Gene name
LocationContig_37:103772..105949
Strand-
Gene length (bp)2177
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00474 SSF Sodium:solute symporter family 1.4E-10 44 398

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 15 193 6.0E-09
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 17 188 4.0E-07
sp|F4KD71|DUR3_ARATH Urea-proton symporter DUR3 OS=Arabidopsis thaliana GN=DUR3 PE=1 SV=1 3 192 5.0E-07

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 47 69 22
3 79 101 22
4 122 141 19
5 161 183 22
6 190 207 17
7 227 249 22
8 269 291 22
9 301 323 22
10 352 371 19
11 376 398 22
12 410 432 22
13 455 477 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5074
MGQPSFAACNAIIYVTYGAFLLMGMGLAWTMRRQSKDEFLSSNGTQSAFPLALNFIASALGAGILFSYPELATLT
GVQGVVIYALASSLPLLVFGALGPLIRRKCPNGFVLTEWTRQRYGTVTMLYLSLLTLVTLFLYMLAELSALGQVV
EALTGLNKLPVIVVECIVTTLYTSLGGFKISFLTDNIQGAMVVGLVVVATITIGVKADIKPELIESSHLTKPSLL
GWHLVYILPVAVLTNDFFLSNFWLRTFSSKTDKDLWIGVSMAMVTVLCVLILVGCTGLIAAWSGVWPGHPPQEGS
LALFLLLEQLPAWVVGLVLVMVISMSTAAFDSLQSAMVSSASNDLFRNRLNIWFTRALVVVIMIPVILLALKAES
ILQIYLISDLLSAATIPVLCLGLVDRFYWWRGFEVVVGGLGGVLTVFIFGTIYYGNADDGGKLLIVKNGLYTKDW
SAFGAFVAAPVGGLVWAMAALALRLAFQYIRARIRKERFDALDVPTEPRDSMSEAGDVQHQVVLATRKAGKFF*
Coding >OphauB2|5074
ATGGGACAACCATCGTTTGCGGCGTGCAACGCCATCATCTATGTAACATATGGCGCCTTTCTTCTGATGGGCATG
GGCCTTGCCTGGACAATGAGAAGACAGAGCAAGGACGAGTTTTTGTCAAGCAACGGAACACAGTCGGCCTTTCCC
TTGGCTCTCAACTTCATCGCTTCTGCGCTGGGAGCTGGCATCCTCTTTTCATACCCGGAGCTTGCAACACTGACT
GGTGTGCAGGGCGTTGTCATTTATGCCCTCGCCTCTTCGCTGCCATTGCTAGTGTTTGGTGCTCTGGGGCCCTTG
ATCCGGCGCAAATGCCCCAATGGCTTCGTCTTGACAGAATGGACGCGACAGCGCTACGGCACCGTGACAATGCTG
TATCTCAGTCTTTTGACACTGGTGACTCTCTTCTTATACATGCTGGCTGAGCTGTCAGCGCTGGGACAGGTGGTG
GAGGCATTGACGGGACTCAACAAGCTACCAGTGATTGTCGTTGAGTGCATTGTCACGACGCTGTATACATCTTTG
GGAGGCTTCAAGATTTCATTTCTTACCGACAACATCCAAGGCGCCATGGTGGTTGGCTTAGTCGTTGTTGCCACA
ATTACAATTGGTGTCAAGGCGGACATCAAGCCCGAGCTTATTGAGTCTTCGCATCTCACCAAACCTTCTCTACTC
GGCTGGCACCTGGTCTACATTTTACCCGTGGCTGTTTTGACCAATGATTTCTTCCTGTCCAACTTTTGGTTGCGC
ACCTTTTCGTCAAAGACGGACAAGGACTTATGGATTGGTGTTTCCATGGCCATGGTTACGGTGCTGTGTGTCTTG
ATTTTGGTGGGATGCACAGGCCTCATTGCCGCCTGGTCGGGTGTCTGGCCAGGCCATCCTCCGCAAGAGGGTTCC
TTGGCTTTGTTTCTGCTGCTGGAGCAGCTGCCGGCATGGGTGGTGGGCCTCGTGCTCGTCATGGTTATCAGCATG
AGTACGGCCGCCTTTGACAGCCTCCAGTCGGCCATGGTTTCATCGGCGTCAAACGACCTCTTCCGCAACCGTCTG
AATATTTGGTTTACTCGTGCTCTGGTGGTGGTTATTATGATACCCGTTATCCTTCTTGCTCTCAAGGCCGAATCC
ATTTTGCAAATATACCTCATCAGCGACCTTCTCTCGGCTGCCACCATCCCCGTCTTGTGCCTGGGGCTGGTTGAC
AGGTTTTACTGGTGGCGCGGCTTTGAGGTGGTTGTTGGCGGCCTCGGAGGTGTCTTGACTGTCTTCATATTCGGC
ACCATTTACTACGGCAATGCCGACGATGGCGGCAAGCTGCTAATTGTCAAAAACGGACTCTACACCAAGGACTGG
AGTGCATTTGGCGCCTTTGTGGCTGCGCCTGTTGGCGGCCTGGTCTGGGCAATGGCAGCTCTCGCTCTCCGATTG
GCCTTTCAATATATTCGCGCCAGGATACGCAAGGAGCGATTCGACGCTCTAGACGTACCTACGGAGCCGCGCGAC
TCGATGAGTGAGGCAGGTGACGTACAGCACCAAGTCGTGCTAGCTACGCGCAAGGCAGGCAAGTTTTTTTAA
Transcript >OphauB2|5074
ATGGGACAACCATCGTTTGCGGCGTGCAACGCCATCATCTATGTAACATATGGCGCCTTTCTTCTGATGGGCATG
GGCCTTGCCTGGACAATGAGAAGACAGAGCAAGGACGAGTTTTTGTCAAGCAACGGAACACAGTCGGCCTTTCCC
TTGGCTCTCAACTTCATCGCTTCTGCGCTGGGAGCTGGCATCCTCTTTTCATACCCGGAGCTTGCAACACTGACT
GGTGTGCAGGGCGTTGTCATTTATGCCCTCGCCTCTTCGCTGCCATTGCTAGTGTTTGGTGCTCTGGGGCCCTTG
ATCCGGCGCAAATGCCCCAATGGCTTCGTCTTGACAGAATGGACGCGACAGCGCTACGGCACCGTGACAATGCTG
TATCTCAGTCTTTTGACACTGGTGACTCTCTTCTTATACATGCTGGCTGAGCTGTCAGCGCTGGGACAGGTGGTG
GAGGCATTGACGGGACTCAACAAGCTACCAGTGATTGTCGTTGAGTGCATTGTCACGACGCTGTATACATCTTTG
GGAGGCTTCAAGATTTCATTTCTTACCGACAACATCCAAGGCGCCATGGTGGTTGGCTTAGTCGTTGTTGCCACA
ATTACAATTGGTGTCAAGGCGGACATCAAGCCCGAGCTTATTGAGTCTTCGCATCTCACCAAACCTTCTCTACTC
GGCTGGCACCTGGTCTACATTTTACCCGTGGCTGTTTTGACCAATGATTTCTTCCTGTCCAACTTTTGGTTGCGC
ACCTTTTCGTCAAAGACGGACAAGGACTTATGGATTGGTGTTTCCATGGCCATGGTTACGGTGCTGTGTGTCTTG
ATTTTGGTGGGATGCACAGGCCTCATTGCCGCCTGGTCGGGTGTCTGGCCAGGCCATCCTCCGCAAGAGGGTTCC
TTGGCTTTGTTTCTGCTGCTGGAGCAGCTGCCGGCATGGGTGGTGGGCCTCGTGCTCGTCATGGTTATCAGCATG
AGTACGGCCGCCTTTGACAGCCTCCAGTCGGCCATGGTTTCATCGGCGTCAAACGACCTCTTCCGCAACCGTCTG
AATATTTGGTTTACTCGTGCTCTGGTGGTGGTTATTATGATACCCGTTATCCTTCTTGCTCTCAAGGCCGAATCC
ATTTTGCAAATATACCTCATCAGCGACCTTCTCTCGGCTGCCACCATCCCCGTCTTGTGCCTGGGGCTGGTTGAC
AGGTTTTACTGGTGGCGCGGCTTTGAGGTGGTTGTTGGCGGCCTCGGAGGTGTCTTGACTGTCTTCATATTCGGC
ACCATTTACTACGGCAATGCCGACGATGGCGGCAAGCTGCTAATTGTCAAAAACGGACTCTACACCAAGGACTGG
AGTGCATTTGGCGCCTTTGTGGCTGCGCCTGTTGGCGGCCTGGTCTGGGCAATGGCAGCTCTCGCTCTCCGATTG
GCCTTTCAATATATTCGCGCCAGGATACGCAAGGAGCGATTCGACGCTCTAGACGTACCTACGGAGCCGCGCGAC
TCGATGAGTGAGGCAGGTGACGTACAGCACCAAGTCGTGCTAGCTACGCGCAAGGCAGGCAAGTTTTTTTAA
Gene >OphauB2|5074
ATGGGACAACCATCGTTTGCGGCGTGCAACGCCATCATCTATGTAACATATGGCGCCTTTCTGTGAGTGCAGCGA
CGAAACTCTGAAGCGAGGCCCATGGGGCTGATGCGAGACAGTCTGATGGGCATGGGCCTTGCCTGGACAATGAGA
AGACAGAGCAAGGACGAGTTTTTGTCAAGCAACGGAACACAGTCGGGTATGCTTGTCGGGCTGGGTCGTTTTACT
GTGCATGTGCTGACTGCATAGCCTTTCCCTTGGCTCTCAACTTCATCGCTTCTGGTGAGTGAGAGGAAGAGCAGA
TATGATCAAGGAGCGGCAGCCGACGGAAGCCACTGGGGCACGATTTGAGCCATGGTGGTGATGGTGGCGACGACG
GCGACGACGACGACGGGTAGGTCATGTCTTGGTCTTGTACCCCTCCCTGGTATGAGGAGCTGTCATTGGTTGTGT
TAGAAGGACGCCGACGACTGCTTCTTGCACCAGAGGAATGGATGTGGCTCACTACGGGCGCCGAGCGAAAGCAGT
GCACGGCAGCATTCCCAGTTGATGTGGGGAGATTGCAGGCCTGCCGACGCGAAGCTGAGATTGCACCGTCATACT
CGATCAAGTTAATGCTTGCGTGGGAAACGTGCTGCCGCTCCAGACCCCCTTATCCTGCCTCGCCTTGTCTTGCCT
GCCCTTGTCTTGGACATGTGACTAACGTGGCAGCTGTCAAGCGCTGGGAGCTGGCATCCTCTTTTCATACCCGGA
GCTTGCAACACTGACTGGTGTGCAGGGCGTTGTCATTTATGCCCTCGCCTCTTCGCTGCCATTGCTAGTGTTTGG
TGCTCTGGGGCCCTTGATCCGGCGCAAATGCCCCAATGGCTTCGTCTTGACAGAATGGACGCGACAGCGCTACGG
CACCGTGACAATGCTGTATCTCAGTCTTTTGACACTGGTGACTCTCTTCTTATACATGCTGGCTGAGCTGTCAGC
GCTGGGACAGGTGGTGGAGGCATTGACGGGACTCAACAAGCTACCAGTGATTGTCGTTGAGTGCATTGTCACGAC
GCTGTATACATGTAAGCTGGCTGCCGTCTGCTGTTGTTCAAGCACGGACAAACTGACTGGGCCGTGGTGCTTTAG
CTTTGGGAGGCTTCAAGATTTCATTTCTTACCGACAACATCCAAGGCGCCATGGTGGTTGGCTTAGTCGTTGTTG
CCACAATTACAATTGGTGTCAAGGCGGACATCAAGCCCGAGCTTATTGAGTCTTCGCATCTCACCAAACCTTCTC
TACTCGGCTGGCACCTGGTCTACATTTTACCCGTGGCTGTTTTGACCAATGATTTCTTCCTGTCCAACTTTTGGT
TGCGCACCTTTTCGTCAAAGACGGACAAGGACTTATGGATTGGTGTTTCCATGGCCATGGTTACGGTGCTGTGTG
TCTTGATTTTGGTGGGATGCACAGGCCTCATTGCCGCCTGGTCGGGTGTCTGGCCAGGCCATCCTCCGCAAGAGG
GTTCCTTGGCTTTGTTTCTGCTGCTGGAGCAGCTGCCGGCATGGGTGGTGGGCCTCGTGCTCGTCATGGTTATCA
GCATGAGTACGGCCGCCTTTGACAGCCTCCAGTCGGCCATGGTTTCATCGGCGTCAAACGACCTCTTCCGCAACC
GTCTGAATATTTGGTTTACTCGTGCTCTGGTGGTGGTTATTATGATACCCGTTATCCTTCTTGCTCTCAAGGCCG
AATCCATTTTGCAAATATACCTCATCAGCGACCTTCTCTCGGCTGCCACCATCCCCGTCTTGTGCCTGGGGCTGG
TTGACAGGTTTTACTGGTGGCGCGGCTTTGAGGTGGTTGTTGGCGGCCTCGGAGGTGTCTTGACTGTCTTCATAT
TCGGCACCATTTACTACGGCAATGCCGACGATGGCGGCAAGCTGCTAATTGTCAAAAACGGACTCTACACCAAGG
ACTGGAGTGCATTTGGCGCCTTTGTGGCTGCGCCTGTTGGCGGCCTGGTCTGGGCAATGGCAGCTCTCGCTCTCC
GATTGGCCTTTCAATATATTCGCGCCAGGATACGCAAGGAGCGATTCGACGCTCTAGACGTACCTACGGAGCCGC
GCGACTCGATGAGTGAGGCAGGTGACGTACAGCACCAAGTCGTGCTAGCTACGCGCAAGGCAGGCAAGTTTTTTT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail