Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5061
Gene name
LocationContig_37:70375..71415
Strand-
Gene length (bp)1040
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 7.8E-05 52 101

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006749 glutathione metabolic process Yes
GO:0006518 peptide metabolic process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7945
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3766
Ophiocordyceps australis map64 (Brazil) OphauB2|5061 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5061
MGPVDDMEPAQSPIYTLHYFPYSLYSLMTRLSFALGRRVSPETAPRLELQLINLHCDDNFSEDYLTKVTPKGQVP
VLTSTALEAPLDDSRDIAKWLCAKQPRLLPQEHRDVIESLMDKIYAFHATALLVAPEDRKDDLKESLPNKAAAML
ERSDLSEGHRRALEIKSVFHDTYYSRILEPEQIEGAEQQVRELMRDLDAILSRHQGQGKTWIFGDEPTILDAHAT
VLASRLAESRRFDMVSEPVRTYADRVQATQDWNEVTQGRPTLWDMSRGHVADLDHL*
Coding >OphauB2|5061
ATGGGCCCAGTCGACGACATGGAGCCTGCCCAGTCTCCCATATACACGCTGCACTACTTTCCCTATTCCCTCTAC
TCACTCATGACGCGCTTGAGCTTTGCCCTGGGCCGGAGAGTGAGCCCCGAGACGGCCCCACGCCTCGAGCTGCAA
CTCATCAACCTCCATTGCGACGACAATTTTTCAGAAGACTATCTCACCAAAGTGACGCCAAAGGGCCAGGTGCCT
GTCCTGACTTCGACGGCGCTCGAGGCACCGCTCGACGACAGCCGGGACATTGCAAAGTGGCTGTGTGCCAAGCAA
CCACGGCTCTTACCCCAAGAGCATCGCGACGTGATTGAAAGCCTCATGGATAAGATCTACGCCTTTCACGCTACA
GCGCTGCTAGTAGCACCCGAGGATCGCAAAGATGACTTGAAGGAAAGCCTTCCCAACAAAGCAGCTGCCATGCTC
GAAAGATCAGATCTGTCCGAGGGGCATCGACGAGCTCTCGAGATTAAGAGCGTCTTCCACGATACATATTATAGC
CGGATATTAGAGCCGGAGCAGATAGAAGGGGCCGAGCAACAGGTGCGCGAGCTCATGAGGGACCTCGATGCCATC
CTGAGCCGACATCAAGGCCAGGGCAAAACGTGGATATTCGGCGACGAGCCCACAATTCTCGACGCCCACGCGACG
GTACTGGCGTCACGACTGGCGGAATCTAGGCGCTTCGACATGGTTTCAGAGCCGGTGCGAACCTATGCCGATAGA
GTACAGGCGACCCAAGACTGGAATGAAGTGACGCAGGGTCGGCCAACCCTGTGGGATATGTCGAGGGGCCATGTG
GCAGACCTGGACCACCTATAA
Transcript >OphauB2|5061
ATGGGCCCAGTCGACGACATGGAGCCTGCCCAGTCTCCCATATACACGCTGCACTACTTTCCCTATTCCCTCTAC
TCACTCATGACGCGCTTGAGCTTTGCCCTGGGCCGGAGAGTGAGCCCCGAGACGGCCCCACGCCTCGAGCTGCAA
CTCATCAACCTCCATTGCGACGACAATTTTTCAGAAGACTATCTCACCAAAGTGACGCCAAAGGGCCAGGTGCCT
GTCCTGACTTCGACGGCGCTCGAGGCACCGCTCGACGACAGCCGGGACATTGCAAAGTGGCTGTGTGCCAAGCAA
CCACGGCTCTTACCCCAAGAGCATCGCGACGTGATTGAAAGCCTCATGGATAAGATCTACGCCTTTCACGCTACA
GCGCTGCTAGTAGCACCCGAGGATCGCAAAGATGACTTGAAGGAAAGCCTTCCCAACAAAGCAGCTGCCATGCTC
GAAAGATCAGATCTGTCCGAGGGGCATCGACGAGCTCTCGAGATTAAGAGCGTCTTCCACGATACATATTATAGC
CGGATATTAGAGCCGGAGCAGATAGAAGGGGCCGAGCAACAGGTGCGCGAGCTCATGAGGGACCTCGATGCCATC
CTGAGCCGACATCAAGGCCAGGGCAAAACGTGGATATTCGGCGACGAGCCCACAATTCTCGACGCCCACGCGACG
GTACTGGCGTCACGACTGGCGGAATCTAGGCGCTTCGACATGGTTTCAGAGCCGGTGCGAACCTATGCCGATAGA
GTACAGGCGACCCAAGACTGGAATGAAGTGACGCAGGGTCGGCCAACCCTGTGGGATATGTCGAGGGGCCATGTG
GCAGACCTGGACCACCTATAA
Gene >OphauB2|5061
ATGGGCCCAGTCGACGACATGGAGCCTGCCCAGTCTCCCATATACACGCTGCACTACTTTCCCTATTCCCTCTAC
TCACTCATGACGCGCTTGAGCTTTGCCCTGGGCCGGAGAGTGAGCCCCGAGACGGCCCCACGCCTCGAGCTGCAA
CTCATCAACCTCCATTGCGACGACAATTTTTCAGAAGACTATCTCACCAAAGTGACGCCAAAGGGCCAGGTCAGC
CATCCACAATACCGACCATGGTGTCGTGCCGACTGCCTTGGGCAATGAGACTGACGAGCATTTTCAGGTGCCTGT
CCTGACTTCGACGGCGCTCGAGGCACCGCTCGACGACAGCCGGGACATTGCAAAGTGGCTGTGTGCCAAGCAACC
ACGGCTCTTACCCCAAGAGCATCGCGACGTGATTGAAAGCCTCATGGATAAGATCTACGCCTTTCACGCTACAGC
GCTGCTAGTAGCACCCGAGGATCGCAAAGATGACTTGAAGGAAAGCCTTCCCAACAAAGCAGCTGCCATGCTCGA
AAGATCAGATCTGTCCGAGGGGCATCGACGAGCTCTCGAGATTAAGAGCGTCTTGTAAGTAGGGGACAACAAGCC
CAAGAGACGGGCCTGTTGACCTTGTGCTTGGGAAATGGCTAAAACAGCCGTCTTTGGAGCCCAGTGCTGACGCGT
TGGATTCCCTCGCACTTTGGGATAGCCACGATACATATTATAGCCGGATATTAGAGCCGGAGCAGATAGAAGGGG
CCGAGCAACAGGTGCGCGAGCTCATGAGGGACCTCGATGCCATCCTGAGCCGACATCAAGGCCAGGGCAAAACGT
GGATATTCGGCGACGAGCCCACAATTCTCGACGCCCACGCGACGGTACTGGCGTCACGACTGGCGGAATCTAGGC
GCTTCGACATGGTTTCAGAGCCGGTGCGAACCTATGCCGATAGAGTACAGGCGACCCAAGACTGGAATGAAGTGA
CGCAGGGTCGGCCAACCCTGTGGGATATGTCGAGGGGCCATGTGGCAGACCTGGACCACCTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail