Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5055
Gene name
LocationContig_37:54319..56348
Strand+
Gene length (bp)2029
Transcript length (bp)1932
Coding sequence length (bp)1932
Protein length (aa) 644

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.6E-04 337 372
PF08238 Sel1 Sel1 repeat 4.3E-07 373 412
PF08238 Sel1 Sel1 repeat 2.0E-08 414 448
PF08238 Sel1 Sel1 repeat 3.7E-01 453 491
PF08238 Sel1 Sel1 repeat 2.3E-07 494 526
PF08238 Sel1 Sel1 repeat 2.5E+00 534 562
PF08238 Sel1 Sel1 repeat 1.1E-02 567 601

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 269 643 8.0E-72
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 296 609 7.0E-53
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 320 612 4.0E-42
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 197 635 9.0E-35
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 337 643 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 269 643 8.0E-72
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 296 609 7.0E-53
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 320 612 4.0E-42
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 197 635 9.0E-35
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 337 643 1.0E-28
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 313 491 2.0E-20
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 313 491 2.0E-20
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 355 621 3.0E-13
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 383 641 1.0E-11
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 351 634 3.0E-11
sp|P77296|YBET_ECOLI Uncharacterized protein YbeT OS=Escherichia coli (strain K12) GN=ybeT PE=2 SV=1 490 612 3.0E-10
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 339 524 5.0E-10
sp|O59732|CHR1_SCHPO Chitin synthase regulatory factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr1 PE=1 SV=1 433 603 1.0E-09
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 339 524 2.0E-09
sp|Q9ZG88|PODJ_CAUCR Localization factor PodJL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=podJ PE=1 SV=2 431 613 6.0E-09
sp|B8GXA0|PODJ_CAUCN Localization factor PodJL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=podJ PE=2 SV=1 431 613 6.0E-09
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 322 506 8.0E-09
sp|Q10NT7|HRD3_ORYSJ ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Oryza sativa subsp. japonica GN=HRD3 PE=2 SV=1 317 601 5.0E-07
sp|O25021|HCPE_HELPY Putative beta-lactamase HcpE OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hcpE PE=3 SV=1 385 546 6.0E-07
sp|Q5UP92|YL018_MIMIV Putative sel1-like repeat-containing protein L18 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L18 PE=4 SV=1 405 590 9.0E-07
sp|Q68CR1|SE1L3_HUMAN Protein sel-1 homolog 3 OS=Homo sapiens GN=SEL1L3 PE=1 SV=2 356 562 6.0E-06
sp|Q80TS8|SE1L3_MOUSE Protein sel-1 homolog 3 OS=Mus musculus GN=Sel1l3 PE=2 SV=3 356 562 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5055
MDARQDMTSLQREVAAPYAGPAGRAIPPRPSTASGTRQQPRRMQTMDPEGPSAYGSHGSEPMPSSDDVFNSYFDN
APGPGTSGQAFPPHQGAHQMPRLHHAKSEATFREPQAAVFEMAGDIPSVPPMPHTKLYQPQFAEGYGGAGYQAVK
PPPRGPSAPPGAANGHQRDDYTGSDGLSRTKTSLSQNSSTNADALPSHPTPVRPGLVSNSGPKLNDRPPPVRNYG
GVPQSGPMRTQVMAPQQQQFQRPFARMGHDVSEGGAPSDPVTTQELEALRMAIKANPADQESALRLARRLIEASD
VLVSKAPDVKHRNKMRDRYLMDAHKILKKLANAQNQDAMFAMADGLGKGLFGHEPDNKEAFTLYQSAAKMGHAAA
AYRTAVCCEIGHEEGGGTRKDPLKAMQWYKRAATLGDPPAMYKVGMILLKGLLGQPKNPREAVGWLKRAAERADT
ENPHALHELGLLYESAQPNDAMIRDERYALTLFLQAADLGYKFSQFRLGCAFEYGLMGCPIDPRQSIYWYSKAAT
QEEHQSELALSGWYLTGSEGVLGQSDTEAYLWARKAAVAGLAKAEYAMGYFTEVGIGVAANLEDAKRWYWRAAAQ
DFPKARERLEDLKRAGKNGRPRQRERISRSRIEKQQEGECSIM*
Coding >OphauB2|5055
ATGGATGCGCGACAAGACATGACGTCGCTGCAACGAGAAGTCGCGGCGCCGTATGCGGGACCCGCTGGTCGGGCA
ATACCGCCCAGGCCATCGACTGCCTCTGGAACCCGACAACAGCCTCGGCGCATGCAAACCATGGACCCAGAGGGA
CCGTCTGCCTACGGCTCGCATGGATCCGAGCCCATGCCTTCGTCGGACGACGTCTTCAACTCTTACTTTGATAAT
GCGCCGGGTCCAGGCACCTCTGGCCAGGCTTTCCCACCACACCAAGGCGCGCACCAGATGCCGAGACTGCATCAC
GCCAAATCAGAAGCCACGTTTCGCGAACCGCAGGCAGCCGTATTCGAAATGGCGGGCGATATTCCATCGGTTCCT
CCAATGCCGCATACCAAGCTCTACCAGCCCCAATTTGCTGAAGGATATGGCGGCGCTGGCTACCAGGCTGTGAAG
CCGCCGCCTCGCGGCCCCAGTGCTCCTCCAGGAGCTGCCAACGGACACCAGCGCGACGACTACACTGGCAGCGAT
GGCCTGTCGAGAACGAAAACCAGCCTTTCGCAGAATAGCAGCACCAATGCCGATGCACTGCCTTCACACCCCACG
CCGGTTCGGCCGGGACTCGTGTCCAATTCGGGCCCCAAGTTGAACGACAGGCCGCCGCCTGTTCGTAACTATGGC
GGCGTGCCTCAGTCTGGCCCAATGCGGACCCAAGTCATGGCGCCACAGCAGCAACAGTTTCAACGGCCCTTTGCT
CGCATGGGCCACGACGTGTCTGAAGGCGGGGCCCCGTCGGACCCTGTGACGACGCAGGAGCTGGAAGCATTGCGC
ATGGCAATCAAGGCAAACCCCGCCGACCAGGAATCAGCACTCCGTCTGGCTAGGCGGCTGATTGAAGCGTCAGAT
GTACTTGTTTCCAAAGCACCAGACGTCAAGCACAGGAACAAGATGCGCGATCGCTACTTGATGGACGCGCACAAA
ATCCTCAAGAAACTGGCCAATGCGCAGAATCAGGATGCCATGTTCGCCATGGCCGACGGGCTTGGCAAAGGCCTC
TTTGGTCACGAGCCTGACAACAAGGAGGCATTCACGCTGTACCAGTCAGCCGCAAAAATGGGCCACGCCGCCGCA
GCGTACAGAACAGCCGTCTGCTGTGAGATTGGCCACGAGGAAGGAGGCGGCACGCGCAAAGATCCCCTCAAGGCA
ATGCAGTGGTACAAGCGAGCTGCCACGCTGGGCGATCCGCCTGCCATGTACAAGGTGGGCATGATTCTGCTCAAG
GGCTTGTTGGGCCAGCCAAAGAACCCCAGAGAGGCAGTCGGATGGCTCAAGCGAGCGGCAGAGCGGGCCGACACG
GAGAATCCACATGCGCTTCACGAGCTGGGACTGCTTTACGAGTCGGCACAGCCAAACGACGCAATGATTCGCGAC
GAGCGTTATGCCCTGACCTTGTTTCTCCAAGCCGCTGATCTGGGATACAAGTTTTCCCAGTTTCGGCTGGGCTGT
GCCTTTGAGTATGGCTTGATGGGCTGCCCCATTGATCCCAGGCAATCCATCTACTGGTACTCCAAGGCGGCGACA
CAAGAGGAACATCAATCAGAGCTGGCCTTGAGCGGCTGGTACCTGACGGGCAGCGAGGGAGTGCTGGGGCAGAGC
GATACGGAAGCCTACCTGTGGGCCAGAAAGGCGGCAGTGGCTGGGCTAGCCAAGGCTGAATATGCCATGGGCTAC
TTTACTGAAGTTGGCATTGGCGTAGCGGCCAACCTGGAAGACGCCAAACGCTGGTATTGGAGAGCTGCAGCCCAA
GACTTTCCCAAAGCTCGCGAGCGGCTCGAAGATCTCAAGAGAGCAGGCAAGAATGGGCGCCCGAGGCAGCGGGAA
CGGATCTCGCGAAGCCGCATCGAGAAGCAGCAAGAAGGCGAATGCAGCATCATGTGA
Transcript >OphauB2|5055
ATGGATGCGCGACAAGACATGACGTCGCTGCAACGAGAAGTCGCGGCGCCGTATGCGGGACCCGCTGGTCGGGCA
ATACCGCCCAGGCCATCGACTGCCTCTGGAACCCGACAACAGCCTCGGCGCATGCAAACCATGGACCCAGAGGGA
CCGTCTGCCTACGGCTCGCATGGATCCGAGCCCATGCCTTCGTCGGACGACGTCTTCAACTCTTACTTTGATAAT
GCGCCGGGTCCAGGCACCTCTGGCCAGGCTTTCCCACCACACCAAGGCGCGCACCAGATGCCGAGACTGCATCAC
GCCAAATCAGAAGCCACGTTTCGCGAACCGCAGGCAGCCGTATTCGAAATGGCGGGCGATATTCCATCGGTTCCT
CCAATGCCGCATACCAAGCTCTACCAGCCCCAATTTGCTGAAGGATATGGCGGCGCTGGCTACCAGGCTGTGAAG
CCGCCGCCTCGCGGCCCCAGTGCTCCTCCAGGAGCTGCCAACGGACACCAGCGCGACGACTACACTGGCAGCGAT
GGCCTGTCGAGAACGAAAACCAGCCTTTCGCAGAATAGCAGCACCAATGCCGATGCACTGCCTTCACACCCCACG
CCGGTTCGGCCGGGACTCGTGTCCAATTCGGGCCCCAAGTTGAACGACAGGCCGCCGCCTGTTCGTAACTATGGC
GGCGTGCCTCAGTCTGGCCCAATGCGGACCCAAGTCATGGCGCCACAGCAGCAACAGTTTCAACGGCCCTTTGCT
CGCATGGGCCACGACGTGTCTGAAGGCGGGGCCCCGTCGGACCCTGTGACGACGCAGGAGCTGGAAGCATTGCGC
ATGGCAATCAAGGCAAACCCCGCCGACCAGGAATCAGCACTCCGTCTGGCTAGGCGGCTGATTGAAGCGTCAGAT
GTACTTGTTTCCAAAGCACCAGACGTCAAGCACAGGAACAAGATGCGCGATCGCTACTTGATGGACGCGCACAAA
ATCCTCAAGAAACTGGCCAATGCGCAGAATCAGGATGCCATGTTCGCCATGGCCGACGGGCTTGGCAAAGGCCTC
TTTGGTCACGAGCCTGACAACAAGGAGGCATTCACGCTGTACCAGTCAGCCGCAAAAATGGGCCACGCCGCCGCA
GCGTACAGAACAGCCGTCTGCTGTGAGATTGGCCACGAGGAAGGAGGCGGCACGCGCAAAGATCCCCTCAAGGCA
ATGCAGTGGTACAAGCGAGCTGCCACGCTGGGCGATCCGCCTGCCATGTACAAGGTGGGCATGATTCTGCTCAAG
GGCTTGTTGGGCCAGCCAAAGAACCCCAGAGAGGCAGTCGGATGGCTCAAGCGAGCGGCAGAGCGGGCCGACACG
GAGAATCCACATGCGCTTCACGAGCTGGGACTGCTTTACGAGTCGGCACAGCCAAACGACGCAATGATTCGCGAC
GAGCGTTATGCCCTGACCTTGTTTCTCCAAGCCGCTGATCTGGGATACAAGTTTTCCCAGTTTCGGCTGGGCTGT
GCCTTTGAGTATGGCTTGATGGGCTGCCCCATTGATCCCAGGCAATCCATCTACTGGTACTCCAAGGCGGCGACA
CAAGAGGAACATCAATCAGAGCTGGCCTTGAGCGGCTGGTACCTGACGGGCAGCGAGGGAGTGCTGGGGCAGAGC
GATACGGAAGCCTACCTGTGGGCCAGAAAGGCGGCAGTGGCTGGGCTAGCCAAGGCTGAATATGCCATGGGCTAC
TTTACTGAAGTTGGCATTGGCGTAGCGGCCAACCTGGAAGACGCCAAACGCTGGTATTGGAGAGCTGCAGCCCAA
GACTTTCCCAAAGCTCGCGAGCGGCTCGAAGATCTCAAGAGAGCAGGCAAGAATGGGCGCCCGAGGCAGCGGGAA
CGGATCTCGCGAAGCCGCATCGAGAAGCAGCAAGAAGGCGAATGCAGCATCATGTGA
Gene >OphauB2|5055
ATGGATGCGCGACAAGACATGACGTCGCTGCAACGAGAAGTCGCGGCGCCGTATGCGGGACCCGCTGGTCGGGCA
ATACCGCCCAGGCCATCGACTGCCTCTGGAACCCGACAACAGCCTCGGCGCATGCAAACCATGGACCCAGAGGGA
CCGTCTGCCTACGGCTCGCATGGATCCGAGCCCATGCCTTCGTCGGACGACGTCTTCAACTCTTACTTTGATAAT
GCGCCGGGTCCAGGCACCTCTGGCCAGGCTTTCCCACCACACCAAGGCGCGCACCAGATGCCGAGACTGCATCAC
GCCAAATCAGAAGCCACGTTTCGCGAACCGCAGGCAGCCGTATTCGAAATGGCGGGCGATATTCCATCGGTTCCT
CCAATGCCGCATACCAAGCTCTACCAGCCCCAATTTGCTGAAGGATATGGCGGCGCTGGCTACCAGGCTGTGAAG
CCGCCGCCTCGCGGCCCCAGTGCTCCTCCAGGAGCTGCCAACGGACACCAGCGCGACGACTACACTGGCAGCGAT
GGCCTGTCGAGAACGAAAACCAGCCTTTCGCAGAATAGCAGCACCAATGCCGATGCACTGCCTTCACACCCCACG
CCGGTTCGGCCGGGACTCGTGTCCAATTCGGGCCCCAAGTTGAACGACAGGCCGCCGCCTGTTCGTAACTATGGC
GGCGTGCCTCAGTCTGGCCCAATGCGGACCCAAGTCATGGCGCCACAGCAGCAACAGTTTCAACGGCCCTTTGCT
CGCATGGGCCACGACGTGTCTGAAGGCGGGGCCCCGTCGGACCCTGTGACGACGCAGGAGCTGGAAGCATTGCGC
ATGGCAATCAAGGCAAACCCCGCCGACCAGGAATCAGCACTCCGTCTGGCTAGGCGGCTGATTGAAGCGTCAGAT
GTACTTGTTTCCAAAGCACCAGACGTCAAGCACAGGAACAAGATGCGCGATCGCTACTTGATGGACGCGCACAAA
ATCCTCAAGAAACTGGCCAATGCGCAGAATCAGGATGCCATGTTCGCCATGGCCGACGGGCTTGGCAAAGGCCTC
TTTGGTCACGAGCCTGACAACAAGGAGGCATTCACGCTGTACCAGTCAGCCGCAAAAATGGGCCACGCCGCCGCA
GCGTACAGAACAGCCGTCTGCTGTGAGATTGGCCACGAGGAAGGAGGCGGCACGCGCAAAGATCCCCTCAAGGCA
ATGCAGTGGTACAAGCGAGCTGCCACGCTGGGCGATCCGCCTGCCATGTACAAGGTGGGCATGATTCTGCTCAAG
GGCTTGTTGGGCCAGCCAAAGAACCCCAGAGAGGCAGTCGGATGGCTCAAGCGAGCGGCAGAGCGGGCCGACACG
GAGAATCCACATGCGCTTCACGAGCTGGGACTGCTTTACGAGTCGGCACAGCCAAACGACGCAATGATTCGCGAC
GAGCGTTATGCCCTGACCTTGTTTCTCCAAGCCGCTGATCTGGGATACAAGTTTTCCCAGTTTCGGCTGGGCTGT
GCCTTTGAGTATGGCTTGATGGGCTGCCCCATTGATCCCAGGCAATCCATCTACTGGTACTCCAAGGCGGCGACA
CAAGAGGAACATCAATCAGAGCTGGCCTTGAGCGGCTGGTACCTGACGGGCAGCGAGGGAGTGCTGGGGCAGAGC
GATACGGAAGCCTACCTGTGGGCCAGAAAGGCGGCAGTGGCTGGGCTAGCCAAGGCTGAATATGCCATGGGCTAC
TTTACTGAAGTTGGCATTGGCGTAGCGGCCAACCTGGAAGACGCCAAACGCTGGTATTGGAGAGCTGCAGGTAAG
AAGTGCTTGCGCAAAACATTGTCACTCCCCCCTTGGATGGTGTGTTTGTTTTTGCACTGGACAATCTCAAGAGAC
TGACGGCGCCATCACAGCCCAAGACTTTCCCAAAGCTCGCGAGCGGCTCGAAGATCTCAAGAGAGCAGGCAAGAA
TGGGCGCCCGAGGCAGCGGGAACGGATCTCGCGAAGCCGCATCGAGAAGCAGCAAGAAGGCGAATGCAGCATCAT
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail