Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5055
Gene name
LocationContig_37:54319..56348
Strand+
Gene length (bp)2029
Transcript length (bp)1932
Coding sequence length (bp)1932
Protein length (aa) 644

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.6E-04 337 372
PF08238 Sel1 Sel1 repeat 4.3E-07 373 412
PF08238 Sel1 Sel1 repeat 2.0E-08 414 448
PF08238 Sel1 Sel1 repeat 3.7E-01 453 491
PF08238 Sel1 Sel1 repeat 2.3E-07 494 526
PF08238 Sel1 Sel1 repeat 2.5E+00 534 562
PF08238 Sel1 Sel1 repeat 1.1E-02 567 601

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 269 643 8.0E-72
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 296 609 7.0E-53
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 320 612 4.0E-42
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 197 635 9.0E-35
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 337 643 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 269 643 8.0E-72
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 296 609 7.0E-53
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 320 612 4.0E-42
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 197 635 9.0E-35
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 337 643 1.0E-28
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 313 491 2.0E-20
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 313 491 2.0E-20
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 355 621 3.0E-13
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 383 641 1.0E-11
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 351 634 3.0E-11
sp|P77296|YBET_ECOLI Uncharacterized protein YbeT OS=Escherichia coli (strain K12) GN=ybeT PE=2 SV=1 490 612 3.0E-10
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 339 524 5.0E-10
sp|O59732|CHR1_SCHPO Chitin synthase regulatory factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr1 PE=1 SV=1 433 603 1.0E-09
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 339 524 2.0E-09
sp|Q9ZG88|PODJ_CAUCR Localization factor PodJL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=podJ PE=1 SV=2 431 613 6.0E-09
sp|B8GXA0|PODJ_CAUCN Localization factor PodJL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=podJ PE=2 SV=1 431 613 6.0E-09
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 322 506 8.0E-09
sp|Q10NT7|HRD3_ORYSJ ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Oryza sativa subsp. japonica GN=HRD3 PE=2 SV=1 317 601 5.0E-07
sp|O25021|HCPE_HELPY Putative beta-lactamase HcpE OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hcpE PE=3 SV=1 385 546 6.0E-07
sp|Q5UP92|YL018_MIMIV Putative sel1-like repeat-containing protein L18 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L18 PE=4 SV=1 405 590 9.0E-07
sp|Q68CR1|SE1L3_HUMAN Protein sel-1 homolog 3 OS=Homo sapiens GN=SEL1L3 PE=1 SV=2 356 562 6.0E-06
sp|Q80TS8|SE1L3_MOUSE Protein sel-1 homolog 3 OS=Mus musculus GN=Sel1l3 PE=2 SV=3 356 562 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4381
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5290
Ophiocordyceps australis map64 (Brazil) OphauB2|5055 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06152
Ophiocordyceps camponoti-rufipedis Ophun1|3126
Ophiocordyceps kimflemingae Ophio5|4353
Ophiocordyceps subramaniannii Hirsu2|9070

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5055
MDARQDMTSLQREVAAPYAGPAGRAIPPRPSTASGTRQQPRRMQTMDPEGPSAYGSHGSEPMPSSDDVFNSYFDN
APGPGTSGQAFPPHQGAHQMPRLHHAKSEATFREPQAAVFEMAGDIPSVPPMPHTKLYQPQFAEGYGGAGYQAVK
PPPRGPSAPPGAANGHQRDDYTGSDGLSRTKTSLSQNSSTNADALPSHPTPVRPGLVSNSGPKLNDRPPPVRNYG
GVPQSGPMRTQVMAPQQQQFQRPFARMGHDVSEGGAPSDPVTTQELEALRMAIKANPADQESALRLARRLIEASD
VLVSKAPDVKHRNKMRDRYLMDAHKILKKLANAQNQDAMFAMADGLGKGLFGHEPDNKEAFTLYQSAAKMGHAAA
AYRTAVCCEIGHEEGGGTRKDPLKAMQWYKRAATLGDPPAMYKVGMILLKGLLGQPKNPREAVGWLKRAAERADT
ENPHALHELGLLYESAQPNDAMIRDERYALTLFLQAADLGYKFSQFRLGCAFEYGLMGCPIDPRQSIYWYSKAAT
QEEHQSELALSGWYLTGSEGVLGQSDTEAYLWARKAAVAGLAKAEYAMGYFTEVGIGVAANLEDAKRWYWRAAAQ
DFPKARERLEDLKRAGKNGRPRQRERISRSRIEKQQEGECSIM*
Coding >OphauB2|5055
ATGGATGCGCGACAAGACATGACGTCGCTGCAACGAGAAGTCGCGGCGCCGTATGCGGGACCCGCTGGTCGGGCA
ATACCGCCCAGGCCATCGACTGCCTCTGGAACCCGACAACAGCCTCGGCGCATGCAAACCATGGACCCAGAGGGA
CCGTCTGCCTACGGCTCGCATGGATCCGAGCCCATGCCTTCGTCGGACGACGTCTTCAACTCTTACTTTGATAAT
GCGCCGGGTCCAGGCACCTCTGGCCAGGCTTTCCCACCACACCAAGGCGCGCACCAGATGCCGAGACTGCATCAC
GCCAAATCAGAAGCCACGTTTCGCGAACCGCAGGCAGCCGTATTCGAAATGGCGGGCGATATTCCATCGGTTCCT
CCAATGCCGCATACCAAGCTCTACCAGCCCCAATTTGCTGAAGGATATGGCGGCGCTGGCTACCAGGCTGTGAAG
CCGCCGCCTCGCGGCCCCAGTGCTCCTCCAGGAGCTGCCAACGGACACCAGCGCGACGACTACACTGGCAGCGAT
GGCCTGTCGAGAACGAAAACCAGCCTTTCGCAGAATAGCAGCACCAATGCCGATGCACTGCCTTCACACCCCACG
CCGGTTCGGCCGGGACTCGTGTCCAATTCGGGCCCCAAGTTGAACGACAGGCCGCCGCCTGTTCGTAACTATGGC
GGCGTGCCTCAGTCTGGCCCAATGCGGACCCAAGTCATGGCGCCACAGCAGCAACAGTTTCAACGGCCCTTTGCT
CGCATGGGCCACGACGTGTCTGAAGGCGGGGCCCCGTCGGACCCTGTGACGACGCAGGAGCTGGAAGCATTGCGC
ATGGCAATCAAGGCAAACCCCGCCGACCAGGAATCAGCACTCCGTCTGGCTAGGCGGCTGATTGAAGCGTCAGAT
GTACTTGTTTCCAAAGCACCAGACGTCAAGCACAGGAACAAGATGCGCGATCGCTACTTGATGGACGCGCACAAA
ATCCTCAAGAAACTGGCCAATGCGCAGAATCAGGATGCCATGTTCGCCATGGCCGACGGGCTTGGCAAAGGCCTC
TTTGGTCACGAGCCTGACAACAAGGAGGCATTCACGCTGTACCAGTCAGCCGCAAAAATGGGCCACGCCGCCGCA
GCGTACAGAACAGCCGTCTGCTGTGAGATTGGCCACGAGGAAGGAGGCGGCACGCGCAAAGATCCCCTCAAGGCA
ATGCAGTGGTACAAGCGAGCTGCCACGCTGGGCGATCCGCCTGCCATGTACAAGGTGGGCATGATTCTGCTCAAG
GGCTTGTTGGGCCAGCCAAAGAACCCCAGAGAGGCAGTCGGATGGCTCAAGCGAGCGGCAGAGCGGGCCGACACG
GAGAATCCACATGCGCTTCACGAGCTGGGACTGCTTTACGAGTCGGCACAGCCAAACGACGCAATGATTCGCGAC
GAGCGTTATGCCCTGACCTTGTTTCTCCAAGCCGCTGATCTGGGATACAAGTTTTCCCAGTTTCGGCTGGGCTGT
GCCTTTGAGTATGGCTTGATGGGCTGCCCCATTGATCCCAGGCAATCCATCTACTGGTACTCCAAGGCGGCGACA
CAAGAGGAACATCAATCAGAGCTGGCCTTGAGCGGCTGGTACCTGACGGGCAGCGAGGGAGTGCTGGGGCAGAGC
GATACGGAAGCCTACCTGTGGGCCAGAAAGGCGGCAGTGGCTGGGCTAGCCAAGGCTGAATATGCCATGGGCTAC
TTTACTGAAGTTGGCATTGGCGTAGCGGCCAACCTGGAAGACGCCAAACGCTGGTATTGGAGAGCTGCAGCCCAA
GACTTTCCCAAAGCTCGCGAGCGGCTCGAAGATCTCAAGAGAGCAGGCAAGAATGGGCGCCCGAGGCAGCGGGAA
CGGATCTCGCGAAGCCGCATCGAGAAGCAGCAAGAAGGCGAATGCAGCATCATGTGA
Transcript >OphauB2|5055
ATGGATGCGCGACAAGACATGACGTCGCTGCAACGAGAAGTCGCGGCGCCGTATGCGGGACCCGCTGGTCGGGCA
ATACCGCCCAGGCCATCGACTGCCTCTGGAACCCGACAACAGCCTCGGCGCATGCAAACCATGGACCCAGAGGGA
CCGTCTGCCTACGGCTCGCATGGATCCGAGCCCATGCCTTCGTCGGACGACGTCTTCAACTCTTACTTTGATAAT
GCGCCGGGTCCAGGCACCTCTGGCCAGGCTTTCCCACCACACCAAGGCGCGCACCAGATGCCGAGACTGCATCAC
GCCAAATCAGAAGCCACGTTTCGCGAACCGCAGGCAGCCGTATTCGAAATGGCGGGCGATATTCCATCGGTTCCT
CCAATGCCGCATACCAAGCTCTACCAGCCCCAATTTGCTGAAGGATATGGCGGCGCTGGCTACCAGGCTGTGAAG
CCGCCGCCTCGCGGCCCCAGTGCTCCTCCAGGAGCTGCCAACGGACACCAGCGCGACGACTACACTGGCAGCGAT
GGCCTGTCGAGAACGAAAACCAGCCTTTCGCAGAATAGCAGCACCAATGCCGATGCACTGCCTTCACACCCCACG
CCGGTTCGGCCGGGACTCGTGTCCAATTCGGGCCCCAAGTTGAACGACAGGCCGCCGCCTGTTCGTAACTATGGC
GGCGTGCCTCAGTCTGGCCCAATGCGGACCCAAGTCATGGCGCCACAGCAGCAACAGTTTCAACGGCCCTTTGCT
CGCATGGGCCACGACGTGTCTGAAGGCGGGGCCCCGTCGGACCCTGTGACGACGCAGGAGCTGGAAGCATTGCGC
ATGGCAATCAAGGCAAACCCCGCCGACCAGGAATCAGCACTCCGTCTGGCTAGGCGGCTGATTGAAGCGTCAGAT
GTACTTGTTTCCAAAGCACCAGACGTCAAGCACAGGAACAAGATGCGCGATCGCTACTTGATGGACGCGCACAAA
ATCCTCAAGAAACTGGCCAATGCGCAGAATCAGGATGCCATGTTCGCCATGGCCGACGGGCTTGGCAAAGGCCTC
TTTGGTCACGAGCCTGACAACAAGGAGGCATTCACGCTGTACCAGTCAGCCGCAAAAATGGGCCACGCCGCCGCA
GCGTACAGAACAGCCGTCTGCTGTGAGATTGGCCACGAGGAAGGAGGCGGCACGCGCAAAGATCCCCTCAAGGCA
ATGCAGTGGTACAAGCGAGCTGCCACGCTGGGCGATCCGCCTGCCATGTACAAGGTGGGCATGATTCTGCTCAAG
GGCTTGTTGGGCCAGCCAAAGAACCCCAGAGAGGCAGTCGGATGGCTCAAGCGAGCGGCAGAGCGGGCCGACACG
GAGAATCCACATGCGCTTCACGAGCTGGGACTGCTTTACGAGTCGGCACAGCCAAACGACGCAATGATTCGCGAC
GAGCGTTATGCCCTGACCTTGTTTCTCCAAGCCGCTGATCTGGGATACAAGTTTTCCCAGTTTCGGCTGGGCTGT
GCCTTTGAGTATGGCTTGATGGGCTGCCCCATTGATCCCAGGCAATCCATCTACTGGTACTCCAAGGCGGCGACA
CAAGAGGAACATCAATCAGAGCTGGCCTTGAGCGGCTGGTACCTGACGGGCAGCGAGGGAGTGCTGGGGCAGAGC
GATACGGAAGCCTACCTGTGGGCCAGAAAGGCGGCAGTGGCTGGGCTAGCCAAGGCTGAATATGCCATGGGCTAC
TTTACTGAAGTTGGCATTGGCGTAGCGGCCAACCTGGAAGACGCCAAACGCTGGTATTGGAGAGCTGCAGCCCAA
GACTTTCCCAAAGCTCGCGAGCGGCTCGAAGATCTCAAGAGAGCAGGCAAGAATGGGCGCCCGAGGCAGCGGGAA
CGGATCTCGCGAAGCCGCATCGAGAAGCAGCAAGAAGGCGAATGCAGCATCATGTGA
Gene >OphauB2|5055
ATGGATGCGCGACAAGACATGACGTCGCTGCAACGAGAAGTCGCGGCGCCGTATGCGGGACCCGCTGGTCGGGCA
ATACCGCCCAGGCCATCGACTGCCTCTGGAACCCGACAACAGCCTCGGCGCATGCAAACCATGGACCCAGAGGGA
CCGTCTGCCTACGGCTCGCATGGATCCGAGCCCATGCCTTCGTCGGACGACGTCTTCAACTCTTACTTTGATAAT
GCGCCGGGTCCAGGCACCTCTGGCCAGGCTTTCCCACCACACCAAGGCGCGCACCAGATGCCGAGACTGCATCAC
GCCAAATCAGAAGCCACGTTTCGCGAACCGCAGGCAGCCGTATTCGAAATGGCGGGCGATATTCCATCGGTTCCT
CCAATGCCGCATACCAAGCTCTACCAGCCCCAATTTGCTGAAGGATATGGCGGCGCTGGCTACCAGGCTGTGAAG
CCGCCGCCTCGCGGCCCCAGTGCTCCTCCAGGAGCTGCCAACGGACACCAGCGCGACGACTACACTGGCAGCGAT
GGCCTGTCGAGAACGAAAACCAGCCTTTCGCAGAATAGCAGCACCAATGCCGATGCACTGCCTTCACACCCCACG
CCGGTTCGGCCGGGACTCGTGTCCAATTCGGGCCCCAAGTTGAACGACAGGCCGCCGCCTGTTCGTAACTATGGC
GGCGTGCCTCAGTCTGGCCCAATGCGGACCCAAGTCATGGCGCCACAGCAGCAACAGTTTCAACGGCCCTTTGCT
CGCATGGGCCACGACGTGTCTGAAGGCGGGGCCCCGTCGGACCCTGTGACGACGCAGGAGCTGGAAGCATTGCGC
ATGGCAATCAAGGCAAACCCCGCCGACCAGGAATCAGCACTCCGTCTGGCTAGGCGGCTGATTGAAGCGTCAGAT
GTACTTGTTTCCAAAGCACCAGACGTCAAGCACAGGAACAAGATGCGCGATCGCTACTTGATGGACGCGCACAAA
ATCCTCAAGAAACTGGCCAATGCGCAGAATCAGGATGCCATGTTCGCCATGGCCGACGGGCTTGGCAAAGGCCTC
TTTGGTCACGAGCCTGACAACAAGGAGGCATTCACGCTGTACCAGTCAGCCGCAAAAATGGGCCACGCCGCCGCA
GCGTACAGAACAGCCGTCTGCTGTGAGATTGGCCACGAGGAAGGAGGCGGCACGCGCAAAGATCCCCTCAAGGCA
ATGCAGTGGTACAAGCGAGCTGCCACGCTGGGCGATCCGCCTGCCATGTACAAGGTGGGCATGATTCTGCTCAAG
GGCTTGTTGGGCCAGCCAAAGAACCCCAGAGAGGCAGTCGGATGGCTCAAGCGAGCGGCAGAGCGGGCCGACACG
GAGAATCCACATGCGCTTCACGAGCTGGGACTGCTTTACGAGTCGGCACAGCCAAACGACGCAATGATTCGCGAC
GAGCGTTATGCCCTGACCTTGTTTCTCCAAGCCGCTGATCTGGGATACAAGTTTTCCCAGTTTCGGCTGGGCTGT
GCCTTTGAGTATGGCTTGATGGGCTGCCCCATTGATCCCAGGCAATCCATCTACTGGTACTCCAAGGCGGCGACA
CAAGAGGAACATCAATCAGAGCTGGCCTTGAGCGGCTGGTACCTGACGGGCAGCGAGGGAGTGCTGGGGCAGAGC
GATACGGAAGCCTACCTGTGGGCCAGAAAGGCGGCAGTGGCTGGGCTAGCCAAGGCTGAATATGCCATGGGCTAC
TTTACTGAAGTTGGCATTGGCGTAGCGGCCAACCTGGAAGACGCCAAACGCTGGTATTGGAGAGCTGCAGGTAAG
AAGTGCTTGCGCAAAACATTGTCACTCCCCCCTTGGATGGTGTGTTTGTTTTTGCACTGGACAATCTCAAGAGAC
TGACGGCGCCATCACAGCCCAAGACTTTCCCAAAGCTCGCGAGCGGCTCGAAGATCTCAAGAGAGCAGGCAAGAA
TGGGCGCCCGAGGCAGCGGGAACGGATCTCGCGAAGCCGCATCGAGAAGCAGCAAGAAGGCGAATGCAGCATCAT
GTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail