Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5045
Gene name
LocationContig_37:33853..34511
Strand-
Gene length (bp)658
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01157 Ribosomal_L21e Ribosomal protein L21e 3.4E-44 1 101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02753|RL21A_YEAST 60S ribosomal protein L21-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL21A PE=1 SV=1 1 160 1.0E-67
sp|Q9UUC1|RL21A_SCHPO 60S ribosomal protein L21-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2101 PE=3 SV=1 1 160 2.0E-67
sp|O42706|RL21B_SCHPO 60S ribosomal protein L21-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2102 PE=2 SV=2 1 160 3.0E-67
sp|Q12672|RL21B_YEAST 60S ribosomal protein L21-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL21B PE=1 SV=1 1 160 3.0E-67
sp|A5JSS2|RL21_CAPHI 60S ribosomal protein L21 OS=Capra hircus GN=RPL21 PE=2 SV=1 1 157 5.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02753|RL21A_YEAST 60S ribosomal protein L21-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL21A PE=1 SV=1 1 160 1.0E-67
sp|Q9UUC1|RL21A_SCHPO 60S ribosomal protein L21-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2101 PE=3 SV=1 1 160 2.0E-67
sp|O42706|RL21B_SCHPO 60S ribosomal protein L21-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2102 PE=2 SV=2 1 160 3.0E-67
sp|Q12672|RL21B_YEAST 60S ribosomal protein L21-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL21B PE=1 SV=1 1 160 3.0E-67
sp|A5JSS2|RL21_CAPHI 60S ribosomal protein L21 OS=Capra hircus GN=RPL21 PE=2 SV=1 1 157 5.0E-58
sp|Q6QN05|RL21_CHILA 60S ribosomal protein L21 OS=Chinchilla lanigera GN=RPL21 PE=2 SV=3 1 157 1.0E-57
sp|P46778|RL21_HUMAN 60S ribosomal protein L21 OS=Homo sapiens GN=RPL21 PE=1 SV=2 1 157 3.0E-57
sp|P20280|RL21_RAT 60S ribosomal protein L21 OS=Rattus norvegicus GN=Rpl21 PE=1 SV=3 1 157 1.0E-55
sp|O09167|RL21_MOUSE 60S ribosomal protein L21 OS=Mus musculus GN=Rpl21 PE=1 SV=3 1 157 2.0E-55
sp|P34334|RL21_CAEEL 60S ribosomal protein L21 OS=Caenorhabditis elegans GN=rpl-21 PE=1 SV=3 1 157 2.0E-51
sp|Q43291|RL211_ARATH 60S ribosomal protein L21-1 OS=Arabidopsis thaliana GN=RPL21A PE=2 SV=2 1 157 2.0E-47
sp|Q9FDZ9|RL212_ARATH 60S ribosomal protein L21-2 OS=Arabidopsis thaliana GN=RPL21E PE=2 SV=1 1 157 3.0E-46
sp|P49667|RL21_PYUST 60S ribosomal protein L21 (Fragment) OS=Pyura stolonifera GN=RPL21 PE=2 SV=2 1 157 2.0E-45
sp|O82574|RL21_CYAPA 60S ribosomal protein L21 OS=Cyanophora paradoxa GN=RPL21 PE=2 SV=1 1 160 9.0E-45
sp|Q54X53|RL21_DICDI 60S ribosomal protein L21 OS=Dictyostelium discoideum GN=rpl21 PE=3 SV=1 1 160 3.0E-42
sp|Q23TC8|RL21_TETTS 60S ribosomal protein L21 OS=Tetrahymena thermophila (strain SB210) GN=RPL21 PE=1 SV=3 1 146 8.0E-37
sp|Q8SRW8|RL21_ENCCU 60S ribosomal protein L21 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL21 PE=3 SV=1 4 156 6.0E-35
sp|P38653|RL21_ENTHI 60S ribosomal protein L21 OS=Entamoeba histolytica GN=RPL21 PE=2 SV=2 1 157 4.0E-29
sp|P49666|RL21_PIG 60S ribosomal protein L21 (Fragment) OS=Sus scrofa GN=RPL21 PE=2 SV=2 1 62 2.0E-18
sp|Q6M125|RL21_METMP 50S ribosomal protein L21e OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl21e PE=3 SV=1 1 100 3.0E-13
sp|A6UR83|RL21_METVS 50S ribosomal protein L21e OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl21e PE=3 SV=1 1 100 6.0E-13
sp|A7I9H8|RL21_METB6 50S ribosomal protein L21e OS=Methanoregula boonei (strain 6A8) GN=rpl21e PE=3 SV=1 1 64 2.0E-12
sp|A9A8J8|RL21_METM6 50S ribosomal protein L21e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl21e PE=3 SV=1 1 100 4.0E-12
sp|A6VI82|RL21_METM7 50S ribosomal protein L21e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl21e PE=3 SV=1 1 100 4.0E-12
sp|A4G096|RL21_METM5 50S ribosomal protein L21e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl21e PE=3 SV=1 1 100 6.0E-12
sp|A3CWY7|RL21_METMJ 50S ribosomal protein L21e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl21e PE=3 SV=1 1 64 1.0E-10
sp|B8GEV3|RL21_METPE 50S ribosomal protein L21e OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl21e PE=3 SV=1 1 97 1.0E-10
sp|A6UT27|RL21_META3 50S ribosomal protein L21e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl21e PE=3 SV=1 1 101 2.0E-10
sp|A3DML6|RL21_STAMF 50S ribosomal protein L21e OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl21e PE=3 SV=1 6 101 1.0E-09
sp|Q975F2|RL21_SULTO 50S ribosomal protein L21e OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl21e PE=3 SV=1 3 64 2.0E-09
sp|Q2FS99|RL21_METHJ 50S ribosomal protein L21e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl21e PE=3 SV=1 1 64 8.0E-09
sp|Q6L228|RL21_PICTO 50S ribosomal protein L21e OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl21e PE=3 SV=1 4 71 3.0E-08
sp|Q12XH4|RL21_METBU 50S ribosomal protein L21e OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl21e PE=3 SV=1 1 64 3.0E-08
sp|Q0W2E9|RL21_METAR 50S ribosomal protein L21e OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl21e PE=3 SV=1 1 66 4.0E-08
sp|P54013|RL21_METJA 50S ribosomal protein L21e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl21e PE=3 SV=2 4 64 1.0E-07
sp|P58077|RL21_AERPE 50S ribosomal protein L21e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl21e PE=3 SV=1 6 77 2.0E-07
sp|Q4JB11|RL21_SULAC 50S ribosomal protein L21e OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl21e PE=3 SV=1 4 64 2.0E-07
sp|Q8PU21|RL21_METMA 50S ribosomal protein L21e OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl21e PE=3 SV=1 1 64 6.0E-07
sp|Q8TQU3|RL21_METAC 50S ribosomal protein L21e OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl21e PE=3 SV=1 1 64 7.0E-07
sp|Q466S9|RL21_METBF 50S ribosomal protein L21e OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl21e PE=3 SV=1 1 64 8.0E-07
sp|A0B7V4|RL21_METTP 50S ribosomal protein L21e OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl21e PE=3 SV=1 1 64 2.0E-06
sp|Q9UXE0|RL21_SULSO 50S ribosomal protein L21e OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl21e PE=3 SV=1 3 96 3.0E-06
sp|C3NHD9|RL21_SULIN 50S ribosomal protein L21e OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl21e PE=3 SV=1 3 96 8.0E-06
sp|C3MVE8|RL21_SULIM 50S ribosomal protein L21e OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl21e PE=3 SV=1 3 96 8.0E-06
sp|C3MQ30|RL21_SULIL 50S ribosomal protein L21e OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl21e PE=3 SV=1 3 96 8.0E-06
sp|C4KHC6|RL21_SULIK 50S ribosomal protein L21e OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl21e PE=3 SV=1 3 96 8.0E-06
sp|C3N5P7|RL21_SULIA 50S ribosomal protein L21e OS=Sulfolobus islandicus (strain M.16.27) GN=rpl21e PE=3 SV=1 3 96 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1952
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5281
Ophiocordyceps australis map64 (Brazil) OphauB2|5045 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06133
Ophiocordyceps camponoti-rufipedis Ophun1|4421
Ophiocordyceps kimflemingae Ophio5|5022
Ophiocordyceps subramaniannii Hirsu2|2100

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5045
MGHSYGKRAGTRYAFSRNYRQKGMIALNTYLRQYRVGDIVDVKVNGAVQKGMPYKVYHGKTGVVYNVTKSAVGVI
IYKKVWHRYIEKRINVRIEHIQQSRSREDFLKRVKLNAEAKKKARAEGVRVQVKRQPALPREARTVSLADNPPET
VTPLPYETTI*
Coding >OphauB2|5045
ATGGGTCACTCGTACGGCAAGAGAGCGGGCACTCGCTATGCCTTTAGCAGAAATTATCGCCAGAAGGGCATGATT
GCCCTCAACACATACCTGAGACAGTATCGTGTTGGCGACATTGTCGATGTCAAGGTGAACGGTGCTGTTCAAAAG
GGCATGCCCTACAAGGTCTACCACGGAAAGACGGGTGTCGTCTACAACGTTACCAAGAGTGCCGTTGGCGTCATC
ATTTACAAGAAGGTGTGGCATCGGTACATTGAGAAGCGCATCAATGTTCGAATTGAGCACATCCAGCAATCCCGA
TCTCGCGAGGACTTCTTGAAGCGAGTCAAGCTGAACGCCGAGGCAAAGAAGAAGGCTCGTGCCGAAGGTGTCCGG
GTTCAAGTCAAGCGCCAGCCCGCGTTGCCCCGCGAGGCACGAACGGTCTCTTTGGCCGACAATCCTCCCGAGACG
GTCACTCCGCTGCCATACGAGACGACGATTTAA
Transcript >OphauB2|5045
ATGGGTCACTCGTACGGCAAGAGAGCGGGCACTCGCTATGCCTTTAGCAGAAATTATCGCCAGAAGGGCATGATT
GCCCTCAACACATACCTGAGACAGTATCGTGTTGGCGACATTGTCGATGTCAAGGTGAACGGTGCTGTTCAAAAG
GGCATGCCCTACAAGGTCTACCACGGAAAGACGGGTGTCGTCTACAACGTTACCAAGAGTGCCGTTGGCGTCATC
ATTTACAAGAAGGTGTGGCATCGGTACATTGAGAAGCGCATCAATGTTCGAATTGAGCACATCCAGCAATCCCGA
TCTCGCGAGGACTTCTTGAAGCGAGTCAAGCTGAACGCCGAGGCAAAGAAGAAGGCTCGTGCCGAAGGTGTCCGG
GTTCAAGTCAAGCGCCAGCCCGCGTTGCCCCGCGAGGCACGAACGGTCTCTTTGGCCGACAATCCTCCCGAGACG
GTCACTCCGCTGCCATACGAGACGACGATTTAA
Gene >OphauB2|5045
ATGGGTCACTCGTACGGCAAGAGAGCGGGCACTCGCGTATGTCGAGATCACTCATTTTGTGCGCCCAAAAACTGA
CACTTTGCAGTATGCCTTTAGCAGAAATTATCGCCAGAAGGGCATGATTGCCCTCAACACATACCTGAGACAGTA
TCGGTTGGTAAACCTACTGAAAGGAAGAGGCATCTATACATACTGACGGACGATAGTGTTGGCGACATTGTCGAT
GTCAAGGTGAACGGTGCTGTTCAAAAGGGGTGAGCGTCGCCACGAGTGCACCACTGATGAGGAGCCTGATTAAGT
CGAGGATATCAACTGACAGGAGGACAGCATGCCCTACAAGGTCTACCACGGAAAGACGGGTGTCGTCTACAACGT
TACCAAGAGTGCCGTTGGCGTCATCATTTACAAGAAGGTGTGGCATCGGTACATTGAGAAGCGCATCAATGTTCG
AATTGAGCACATCCAGCAATCCCGATCTCGCGAGGACTTCTTGAAGCGAGTCAAGCTGAACGCCGAGGCAAAGAA
GAAGGCTCGTGCCGAAGGTGTCCGGGTTCAAGTCAAGCGCCAGCCCGCGTTGCCCCGCGAGGCACGAACGGTCTC
TTTGGCCGACAATCCTCCCGAGACGGTCACTCCGCTGCCATACGAGACGACGATTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail