Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5042
Gene name
LocationContig_37:25901..26805
Strand-
Gene length (bp)904
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 3.0E-18 128 194
PF09011 HMG_box_2 HMG-box domain 1.4E-04 128 186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36981|MATB_NEUCS Mating-type protein a-1 OS=Neurospora crassa GN=mta-1 PE=1 SV=2 20 207 1.0E-22
sp|P35693|FPR1_PODAS MAT+ sexual cell fertilization-promoting factor OS=Podospora anserina GN=FPR1 PE=3 SV=2 32 203 3.0E-21
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 129 205 3.0E-15
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 129 205 3.0E-15
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 129 205 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36981|MATB_NEUCS Mating-type protein a-1 OS=Neurospora crassa GN=mta-1 PE=1 SV=2 20 207 1.0E-22
sp|P35693|FPR1_PODAS MAT+ sexual cell fertilization-promoting factor OS=Podospora anserina GN=FPR1 PE=3 SV=2 32 203 3.0E-21
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 129 205 3.0E-15
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 129 205 3.0E-15
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 129 205 3.0E-15
sp|Q6WRX6|MATMC_SCHKA Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces kambucha GN=matMc PE=3 SV=1 129 205 3.0E-15
sp|Q6F2F0|S17B3_XENTR Transcription factor Sox-17-beta.3 OS=Xenopus tropicalis GN=sox17b.3 PE=3 SV=2 116 221 3.0E-13
sp|Q8AWH3|SX17A_XENTR Transcription factor Sox-17-alpha OS=Xenopus tropicalis GN=sox17a PE=2 SV=1 106 209 3.0E-13
sp|Q3KQ35|S17AA_XENLA Transcription factor Sox-17-alpha-A OS=Xenopus laevis GN=sox17a-a PE=1 SV=1 106 209 4.0E-13
sp|A5D8R3|S17B3_XENLA Transcription factor Sox-17-beta.3 OS=Xenopus laevis GN=sox17b.3 PE=2 SV=1 113 223 5.0E-13
sp|P36389|SRY_HORSE Sex-determining region Y protein OS=Equus caballus GN=SRY PE=2 SV=2 74 203 1.0E-12
sp|Q8AWH2|S17B1_XENTR Transcription factor Sox-17-beta.1 OS=Xenopus tropicalis GN=sox17b.1 PE=2 SV=1 116 212 4.0E-12
sp|O42601|S17B1_XENLA Transcription factor Sox-17-beta.1 OS=Xenopus laevis GN=sox17b.1 PE=1 SV=1 113 211 6.0E-12
sp|P40657|SOX15_DROME Putative transcription factor SOX-15 OS=Drosophila melanogaster GN=Sox15 PE=2 SV=2 123 239 2.0E-11
sp|Q6GLH8|S17B2_XENTR Transcription factor Sox-17-beta.2 OS=Xenopus tropicalis GN=sox17b.2 PE=2 SV=2 116 206 4.0E-11
sp|Q61473|SOX17_MOUSE Transcription factor SOX-17 OS=Mus musculus GN=Sox17 PE=1 SV=1 122 227 5.0E-11
sp|Q90ZH9|S17AB_XENLA Transcription factor Sox-17-alpha-B OS=Xenopus laevis GN=sox17a-b PE=1 SV=1 106 209 1.0E-10
sp|Q9H6I2|SOX17_HUMAN Transcription factor SOX-17 OS=Homo sapiens GN=SOX17 PE=1 SV=1 124 227 1.0E-10
sp|B0ZTE2|SOX14_XENLA Transcription factor Sox-14 OS=Xenopus laevis GN=sox14 PE=2 SV=1 127 243 1.0E-09
sp|Q28GD5|SOX7_XENTR Transcription factor Sox-7 OS=Xenopus tropicalis GN=sox7 PE=2 SV=1 101 206 1.0E-09
sp|Q24533|DICH_DROME SOX domain-containing protein dichaete OS=Drosophila melanogaster GN=D PE=2 SV=1 120 200 2.0E-09
sp|Q863D9|SRY_ALCAC Sex-determining region Y protein OS=Alces alces cameloides GN=SRY PE=3 SV=1 127 207 2.0E-09
sp|P36396|SRY_URSAR Sex-determining region Y protein OS=Ursus arctos GN=SRY PE=3 SV=2 127 228 3.0E-09
sp|O42342|SOX7_XENLA Transcription factor Sox-7 OS=Xenopus laevis GN=sox7 PE=2 SV=1 101 206 3.0E-09
sp|P43680|SOX18_MOUSE Transcription factor SOX-18 OS=Mus musculus GN=Sox18 PE=1 SV=3 124 209 3.0E-09
sp|P35713|SOX18_HUMAN Transcription factor SOX-18 OS=Homo sapiens GN=SOX18 PE=1 SV=2 124 209 3.0E-09
sp|A4QNG3|SOX14_XENTR Transcription factor Sox-14 OS=Xenopus tropicalis GN=sox14 PE=2 SV=1 127 236 3.0E-09
sp|Q6TC36|SRY_PAGGO Sex-determining region Y protein OS=Pagophilus groenlandicus GN=SRY PE=3 SV=1 114 200 3.0E-09
sp|Q6TC39|SRY_MIRAN Sex-determining region Y protein OS=Mirounga angustirostris GN=SRY PE=3 SV=1 127 228 7.0E-09
sp|Q6TC46|SRY_EUMJU Sex-determining region Y protein OS=Eumetopias jubatus GN=SRY PE=3 SV=1 127 200 7.0E-09
sp|Q6T724|SRY_ARCFO Sex-determining region Y protein OS=Arctocephalus forsteri GN=SRY PE=3 SV=1 127 200 7.0E-09
sp|Q6T723|SRY_ARCAU Sex-determining region Y protein OS=Arctocephalus australis GN=SRY PE=3 SV=1 127 200 7.0E-09
sp|Q6TC30|SRY_ERIBA Sex-determining region Y protein OS=Erignathus barbatus GN=SRY PE=3 SV=1 127 200 7.0E-09
sp|Q6TC40|SRY_HYDLE Sex-determining region Y protein OS=Hydrurga leptonyx GN=SRY PE=3 SV=1 127 200 7.0E-09
sp|Q6TC44|SRY_ARCGZ Sex-determining region Y protein OS=Arctocephalus gazella GN=SRY PE=3 SV=1 127 200 8.0E-09
sp|Q6TC27|SRY_ENHLU Sex-determining region Y protein OS=Enhydra lutris GN=SRY PE=3 SV=1 114 200 8.0E-09
sp|Q6TC45|SRY_ZALCA Sex-determining region Y protein OS=Zalophus californianus GN=SRY PE=3 SV=1 127 200 8.0E-09
sp|Q6TC38|SRY_MIRLE Sex-determining region Y protein OS=Mirounga leonina GN=SRY PE=3 SV=1 127 228 8.0E-09
sp|Q6TC43|SRY_CALUR Sex-determining region Y protein OS=Callorhinus ursinus GN=SRY PE=3 SV=1 127 200 8.0E-09
sp|Q9XT60|SRY_CANLF Sex-determining region Y protein OS=Canis lupus familiaris GN=SRY PE=3 SV=1 127 200 9.0E-09
sp|P36390|SRY_HALGR Sex-determining region Y protein OS=Halichoerus grypus GN=SRY PE=3 SV=2 127 200 9.0E-09
sp|Q6TC32|SRY_PUSHI Sex-determining region Y protein OS=Pusa hispida GN=SRY PE=3 SV=1 127 200 9.0E-09
sp|Q03257|SRY_SHEEP Sex-determining region Y protein OS=Ovis aries GN=SRY PE=3 SV=2 54 204 9.0E-09
sp|Q6TC28|SRY_LUTLU Sex-determining region Y protein OS=Lutra lutra GN=SRY PE=3 SV=1 124 200 9.0E-09
sp|Q6TC37|SRY_CYSCR Sex-determining region Y protein OS=Cystophora cristata GN=SRY PE=3 SV=1 127 200 1.0E-08
sp|Q6TC33|SRY_PHOVI Sex-determining region Y protein OS=Phoca vitulina GN=SRY PE=3 SV=1 127 200 1.0E-08
sp|Q6TC31|SRY_PHOLR Sex-determining region Y protein OS=Phoca largha GN=SRY PE=3 SV=1 127 200 1.0E-08
sp|Q863B7|SRY_ELADA Sex-determining region Y protein OS=Elaphurus davidianus GN=SRY PE=3 SV=1 127 207 1.0E-08
sp|Q6TC34|SRY_PUSCA Sex-determining region Y protein OS=Pusa caspica GN=SRY PE=3 SV=1 127 200 1.0E-08
sp|P40646|SOX7_MOUSE Transcription factor SOX-7 OS=Mus musculus GN=Sox7 PE=1 SV=2 124 206 1.0E-08
sp|Q6RVD7|SX21B_DANRE Transcription factor Sox-21-B OS=Danio rerio GN=sox21b PE=2 SV=1 127 200 1.0E-08
sp|P61259|SOX14_MACFA Transcription factor SOX-14 OS=Macaca fascicularis GN=SOX14 PE=2 SV=1 127 240 1.0E-08
sp|O95416|SOX14_HUMAN Transcription factor SOX-14 OS=Homo sapiens GN=SOX14 PE=1 SV=1 127 240 1.0E-08
sp|Q863C2|SRY_AXIPR Sex-determining region Y protein OS=Axis porcinus GN=SRY PE=3 SV=1 127 207 1.0E-08
sp|Q864Q7|SRY_EUBAS Sex-determining region Y protein OS=Eubalaena australis GN=SRY PE=3 SV=1 99 204 1.0E-08
sp|B3DLD3|SOX18_XENTR Transcription factor Sox-18 OS=Xenopus tropicalis GN=sox18 PE=2 SV=1 127 251 1.0E-08
sp|Q32PP9|SOX14_DANRE Transcription factor Sox-14 OS=Danio rerio GN=sox14 PE=2 SV=1 127 200 1.0E-08
sp|Q04892|SOX14_MOUSE Transcription factor SOX-14 OS=Mus musculus GN=Sox14 PE=2 SV=2 127 240 1.0E-08
sp|Q08143|SMR2_PODAS Sporulation minus regulator 2 OS=Podospora anserina GN=SMR2 PE=3 SV=1 127 207 2.0E-08
sp|Q9BT81|SOX7_HUMAN Transcription factor SOX-7 OS=Homo sapiens GN=SOX7 PE=1 SV=1 124 206 2.0E-08
sp|P36393|SRY_PIG Sex-determining region Y protein OS=Sus scrofa GN=SRY PE=2 SV=3 127 204 2.0E-08
sp|Q2Z1R2|SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio GN=sox1b PE=2 SV=1 127 200 2.0E-08
sp|B0ZTE1|SOX21_XENLA Transcription factor Sox-21 OS=Xenopus laevis GN=sox21 PE=2 SV=1 127 200 2.0E-08
sp|Q9W7R6|SOX14_CHICK Transcription factor SOX-14 OS=Gallus gallus GN=SOX14 PE=2 SV=1 127 200 2.0E-08
sp|Q864Q8|SRY_MEGNO Sex-determining region Y protein OS=Megaptera novaeangliae GN=SRY PE=3 SV=1 99 204 3.0E-08
sp|Q9BH08|SRY_CERNI Sex-determining region Y protein OS=Cervus nippon GN=SRY PE=3 SV=1 127 207 3.0E-08
sp|Q864R1|SRY_BALBN Sex-determining region Y protein OS=Balaenoptera bonaerensis GN=SRY PE=3 SV=1 99 204 3.0E-08
sp|Q864R2|SRY_BALAC Sex-determining region Y protein OS=Balaenoptera acutorostrata GN=SRY PE=3 SV=1 99 204 3.0E-08
sp|Q6EJB7|SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio GN=sox3 PE=1 SV=1 127 200 3.0E-08
sp|Q864Q9|SRY_BALPH Sex-determining region Y protein OS=Balaenoptera physalus GN=SRY PE=3 SV=1 99 204 3.0E-08
sp|Q9Y651|SOX21_HUMAN Transcription factor SOX-21 OS=Homo sapiens GN=SOX21 PE=2 SV=1 127 200 3.0E-08
sp|Q864R0|SRY_BALMU Sex-determining region Y protein OS=Balaenoptera musculus GN=SRY PE=3 SV=1 99 204 3.0E-08
sp|Q811W0|SOX21_MOUSE Transcription factor SOX-21 OS=Mus musculus GN=Sox21 PE=2 SV=1 127 200 3.0E-08
sp|P48430|SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus GN=SOX2 PE=1 SV=1 127 259 4.0E-08
sp|O42569|SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis GN=sox2 PE=2 SV=1 127 259 4.0E-08
sp|Q6TC41|SRY_MONSC Sex-determining region Y protein OS=Monachus schauinslandi GN=SRY PE=3 SV=1 127 199 5.0E-08
sp|Q6P0E1|SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio GN=sox2 PE=2 SV=1 127 203 5.0E-08
sp|Q9BG90|SRY_MACMU Sex-determining region Y protein OS=Macaca mulatta GN=SRY PE=2 SV=1 127 200 5.0E-08
sp|P51501|SRY_CALJA Sex-determining region Y protein OS=Callithrix jacchus GN=SRY PE=3 SV=1 127 200 6.0E-08
sp|Q69FB1|SRY_BUBBU Sex-determining region Y protein OS=Bubalus bubalis GN=SRY PE=3 SV=1 127 204 6.0E-08
sp|Q03256|SRY_CAPHI Sex-determining region Y protein OS=Capra hircus GN=SRY PE=3 SV=2 127 204 6.0E-08
sp|Q6NVN0|SOX2_XENTR Transcription factor Sox-2 OS=Xenopus tropicalis GN=sox2 PE=2 SV=1 127 200 6.0E-08
sp|Q8SPQ1|SRY_BOSJA Sex-determining region Y protein OS=Bos javanicus GN=SRY PE=3 SV=1 127 204 6.0E-08
sp|Q90ZH8|SX18A_XENLA Transcription factor Sox-18A OS=Xenopus laevis GN=sox18-a PE=1 SV=1 127 214 7.0E-08
sp|Q28447|SRY_HYLLA Sex-determining region Y protein OS=Hylobates lar GN=SRY PE=3 SV=1 127 200 8.0E-08
sp|Q28783|SRY_PONPY Sex-determining region Y protein OS=Pongo pygmaeus GN=SRY PE=3 SV=1 127 200 8.0E-08
sp|Q6TC50|SRY_FELCA Sex-determining region Y protein OS=Felis catus GN=SRY PE=3 SV=1 127 228 8.0E-08
sp|P48432|SOX2_MOUSE Transcription factor SOX-2 OS=Mus musculus GN=Sox2 PE=1 SV=2 127 200 8.0E-08
sp|P48431|SOX2_HUMAN Transcription factor SOX-2 OS=Homo sapiens GN=SOX2 PE=1 SV=1 127 200 8.0E-08
sp|Q90ZH7|SX18B_XENLA Transcription factor Sox-18B OS=Xenopus laevis GN=sox18-b PE=1 SV=1 127 209 8.0E-08
sp|P54231|SOX2_SHEEP Transcription factor SOX-2 OS=Ovis aries GN=SOX2 PE=3 SV=1 127 200 8.0E-08
sp|P36631|STE11_SCHPO Transcription factor ste11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste11 PE=1 SV=2 123 209 9.0E-08
sp|Q6DGL6|SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio GN=sox1a PE=2 SV=2 127 200 9.0E-08
sp|A2TED3|SOX1_XENTR Transcription factor Sox-1 OS=Xenopus tropicalis GN=sox1 PE=2 SV=1 127 200 1.0E-07
sp|Q67EX7|SRY_MOSBE Sex-determining region Y protein OS=Moschus berezovskii GN=SRY PE=3 SV=1 127 204 1.0E-07
sp|P48046|SRY_GORGO Sex-determining region Y protein OS=Gorilla gorilla gorilla GN=SRY PE=3 SV=1 127 200 1.0E-07
sp|Q2PG84|SOX1_XENLA Transcription factor Sox-1 OS=Xenopus laevis GN=sox1 PE=2 SV=1 127 200 1.0E-07
sp|Q05066|SRY_HUMAN Sex-determining region Y protein OS=Homo sapiens GN=SRY PE=1 SV=1 127 200 1.0E-07
sp|P53783|SOX1_MOUSE Transcription factor SOX-1 OS=Mus musculus GN=Sox1 PE=2 SV=2 127 200 1.0E-07
sp|O00570|SOX1_HUMAN Transcription factor SOX-1 OS=Homo sapiens GN=SOX1 PE=1 SV=2 127 200 1.0E-07
sp|O57401|SOX1_CHICK Transcription factor SOX-1 OS=Gallus gallus GN=SOX1 PE=2 SV=1 127 200 1.0E-07
sp|Q7SZS1|SX21A_DANRE Transcription factor Sox-21-A OS=Danio rerio GN=sox21a PE=2 SV=1 127 200 2.0E-07
sp|Q864Q4|SRY_MESST Sex-determining region Y protein OS=Mesoplodon stejnegeri GN=SRY PE=3 SV=1 99 204 2.0E-07
sp|Q9W7R5|SOX21_CHICK Transcription factor SOX-21 OS=Gallus gallus GN=SOX21 PE=2 SV=1 127 200 2.0E-07
sp|P43267|SOX15_MOUSE Protein SOX-15 OS=Mus musculus GN=Sox15 PE=1 SV=3 127 203 2.0E-07
sp|Q864Q2|SRY_PHOPH Sex-determining region Y protein OS=Phocoena phocoena GN=SRY PE=3 SV=1 99 203 2.0E-07
sp|Q864Q1|SRY_NEOPH Sex-determining region Y protein OS=Neophocaena phocaenoides GN=SRY PE=3 SV=1 99 203 2.0E-07
sp|Q9DDD7|SX19B_DANRE Transcription factor Sox-19b OS=Danio rerio GN=sox19b PE=1 SV=1 127 210 2.0E-07
sp|Q864P7|SRY_GRAGR Sex-determining region Y protein OS=Grampus griseus GN=SRY PE=3 SV=1 99 203 2.0E-07
sp|Q864Q5|SRY_KOGSI Sex-determining region Y protein OS=Kogia sima GN=SRY PE=3 SV=1 99 204 2.0E-07
sp|Q864Q0|SRY_TURTR Sex-determining region Y protein OS=Tursiops truncatus GN=SRY PE=3 SV=1 99 203 3.0E-07
sp|Q864P6|SRY_PENEL Sex-determining region Y protein OS=Peponocephala electra GN=SRY PE=3 SV=1 99 203 3.0E-07
sp|Q864P8|SRY_LAGOL Sex-determining region Y protein OS=Lagenorhynchus obliquidens GN=SRY PE=3 SV=1 99 203 3.0E-07
sp|Q864P4|SRY_GLOMA Sex-determining region Y protein OS=Globicephala macrorhynchus GN=SRY PE=3 SV=2 99 203 3.0E-07
sp|Q864P9|SRY_DELDE Sex-determining region Y protein OS=Delphinus delphis GN=SRY PE=3 SV=1 99 203 3.0E-07
sp|Q864P3|SRY_ORCBR Sex-determining region Y protein OS=Orcaella brevirostris GN=SRY PE=3 SV=1 99 203 3.0E-07
sp|P48433|SOX3_CHICK Transcription factor SOX-3 OS=Gallus gallus GN=SOX3 PE=2 SV=1 127 200 3.0E-07
sp|Q9UN79|SOX13_HUMAN Transcription factor SOX-13 OS=Homo sapiens GN=SOX13 PE=1 SV=3 119 199 3.0E-07
sp|Q864Q3|SRY_DELLE Sex-determining region Y protein OS=Delphinapterus leucas GN=SRY PE=3 SV=1 99 203 3.0E-07
sp|Q04886|SOX8_MOUSE Transcription factor SOX-8 OS=Mus musculus GN=Sox8 PE=2 SV=2 122 245 3.0E-07
sp|Q28778|SRY_PANPA Sex-determining region Y protein OS=Pan paniscus GN=SRY PE=3 SV=1 127 200 3.0E-07
sp|P53784|SOX3_MOUSE Transcription factor SOX-3 OS=Mus musculus GN=Sox3 PE=1 SV=2 127 200 4.0E-07
sp|Q68FA4|SOX3_XENTR Transcription factor Sox-3 OS=Xenopus tropicalis GN=sox3 PE=2 SV=1 127 200 4.0E-07
sp|Q7JGF7|SRY_BOSIN Sex-determining region Y protein OS=Bos indicus GN=SRY PE=3 SV=1 127 204 4.0E-07
sp|Q7JGF9|SRY_BOSGF Sex-determining region Y protein OS=Bos gaurus frontalis GN=SRY PE=3 SV=1 127 204 4.0E-07
sp|Q27949|SRY_BISBO Sex-determining region Y protein OS=Bison bonasus GN=SRY PE=3 SV=2 127 204 4.0E-07
sp|Q03255|SRY_BOVIN Sex-determining region Y protein OS=Bos taurus GN=SRY PE=3 SV=2 127 204 4.0E-07
sp|Q8SPQ2|SRY_BISBI Sex-determining region Y protein OS=Bison bison GN=SRY PE=3 SV=1 127 204 4.0E-07
sp|Q864P5|SRY_ORCOR Sex-determining region Y protein OS=Orcinus orca GN=SRY PE=3 SV=1 127 203 4.0E-07
sp|Q28798|SRY_PANTR Sex-determining region Y protein OS=Pan troglodytes GN=SRY PE=2 SV=1 127 200 5.0E-07
sp|Q9P445|MAT2_COCSA Mating-type protein MAT-2 OS=Cochliobolus sativus GN=MAT2 PE=3 SV=1 129 203 5.0E-07
sp|P47792|SX19A_DANRE Transcription factor Sox-19a OS=Danio rerio GN=sox19a PE=1 SV=2 127 210 5.0E-07
sp|O60248|SOX15_HUMAN Protein SOX-15 OS=Homo sapiens GN=SOX15 PE=1 SV=1 127 235 5.0E-07
sp|Q5FWM3|SOX3B_XENLA Transcription factor Sox-3-B OS=Xenopus laevis GN=sox3-b PE=2 SV=1 127 200 5.0E-07
sp|Q924A2|CIC_MOUSE Protein capicua homolog OS=Mus musculus GN=Cic PE=1 SV=2 118 214 6.0E-07
sp|P55863|SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis GN=sox3-a PE=1 SV=1 127 200 6.0E-07
sp|Q96RK0|CIC_HUMAN Protein capicua homolog OS=Homo sapiens GN=CIC PE=1 SV=2 118 214 6.0E-07
sp|Q02991|MAT2_COCHE Mating-type protein MAT-2 OS=Cochliobolus heterostrophus GN=MAT2 PE=3 SV=1 129 203 6.0E-07
sp|P41225|SOX3_HUMAN Transcription factor SOX-3 OS=Homo sapiens GN=SOX3 PE=1 SV=2 127 200 7.0E-07
sp|Q91731|SX11A_XENLA Transcription factor Sox-11-A OS=Xenopus laevis GN=sox11-a PE=1 SV=2 110 200 8.0E-07
sp|Q8AXX8|SOX10_XENLA Transcription factor Sox-10 OS=Xenopus laevis GN=sox10 PE=1 SV=1 122 246 9.0E-07
sp|A5A763|SOX10_PIG Transcription factor SOX-10 OS=Sus scrofa GN=SOX10 PE=2 SV=1 122 243 1.0E-06
sp|Q23045|EGL13_CAEEL Transcription factor egl-13 OS=Caenorhabditis elegans GN=egl-13 PE=1 SV=2 89 199 1.0E-06
sp|P56693|SOX10_HUMAN Transcription factor SOX-10 OS=Homo sapiens GN=SOX10 PE=1 SV=1 122 244 1.0E-06
sp|A4IIJ8|SOX10_XENTR Transcription factor Sox-10 OS=Xenopus tropicalis GN=sox10 PE=2 SV=1 122 246 1.0E-06
sp|P0C1G9|SOX11_RAT Transcription factor SOX-11 OS=Rattus norvegicus GN=Sox11 PE=2 SV=1 110 200 1.0E-06
sp|P36394|SRY_RAT Sex-determining region Y protein (Fragment) OS=Rattus norvegicus GN=Sry PE=1 SV=2 124 200 1.0E-06
sp|Q7M6Y2|SOX11_MOUSE Transcription factor SOX-11 OS=Mus musculus GN=Sox11 PE=1 SV=1 110 200 1.0E-06
sp|Q864Q6|SRY_PHYCD Sex-determining region Y protein OS=Physeter catodon GN=SRY PE=3 SV=1 99 204 1.0E-06
sp|Q5A220|RFG1_CANAL Repressor of filamentous growth 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFG1 PE=2 SV=2 127 200 1.0E-06
sp|Q04888|SOX10_MOUSE Transcription factor SOX-10 OS=Mus musculus GN=Sox10 PE=2 SV=2 122 243 2.0E-06
sp|P40650|SX11B_XENLA Transcription factor Sox-11-B OS=Xenopus laevis GN=sox11-b PE=1 SV=2 117 200 2.0E-06
sp|P57073|SOX8_HUMAN Transcription factor SOX-8 OS=Homo sapiens GN=SOX8 PE=2 SV=1 122 245 2.0E-06
sp|P35710|SOX5_MOUSE Transcription factor SOX-5 OS=Mus musculus GN=Sox5 PE=1 SV=2 124 199 2.0E-06
sp|Q9U1H0|CIC_DROME Putative transcription factor capicua OS=Drosophila melanogaster GN=cic PE=1 SV=2 127 241 2.0E-06
sp|P35711|SOX5_HUMAN Transcription factor SOX-5 OS=Homo sapiens GN=SOX5 PE=1 SV=3 124 199 2.0E-06
sp|Q66JF1|SOX11_XENTR Transcription factor Sox-11 OS=Xenopus tropicalis GN=sox11 PE=2 SV=1 110 200 2.0E-06
sp|P35716|SOX11_HUMAN Transcription factor SOX-11 OS=Homo sapiens GN=SOX11 PE=1 SV=2 110 200 2.0E-06
sp|P40656|SOX14_DROME Putative transcription factor SOX-14 OS=Drosophila melanogaster GN=Sox14 PE=2 SV=3 88 204 2.0E-06
sp|B3DM43|SOX5_XENTR Transcription factor Sox-5 OS=Xenopus tropicalis GN=sox5 PE=2 SV=1 124 199 2.0E-06
sp|Q67EX6|SRY_MOSCH Sex-determining region Y protein OS=Moschus chrysogaster GN=SRY PE=3 SV=1 127 204 2.0E-06
sp|O55170|SOX10_RAT Transcription factor SOX-10 OS=Rattus norvegicus GN=Sox10 PE=1 SV=1 122 243 2.0E-06
sp|Q04891|SOX13_MOUSE Transcription factor SOX-13 OS=Mus musculus GN=Sox13 PE=2 SV=4 120 199 2.0E-06
sp|P48435|SOX11_CHICK Transcription factor SOX-11 OS=Gallus gallus GN=SOX11 PE=2 SV=1 110 200 3.0E-06
sp|Q8VBW5|BBX_MOUSE HMG box transcription factor BBX OS=Mus musculus GN=Bbx PE=1 SV=2 124 198 3.0E-06
sp|P57074|SOX8_CHICK Transcription factor SOX-8 OS=Gallus gallus GN=SOX8 PE=2 SV=1 122 245 3.0E-06
sp|Q8WY36|BBX_HUMAN HMG box transcription factor BBX OS=Homo sapiens GN=BBX PE=1 SV=1 111 198 3.0E-06
sp|P40647|SOX5_XENLA Transcription factor Sox-5 OS=Xenopus laevis GN=sox5 PE=2 SV=2 124 199 3.0E-06
sp|Q6VVD7|SOX8_XENLA Transcription factor Sox-8 OS=Xenopus laevis GN=sox8 PE=2 SV=1 122 244 3.0E-06
sp|Q9XS37|SRY_BOSMU Sex-determining region Y protein OS=Bos mutus grunniens GN=SRY PE=3 SV=1 127 204 4.0E-06
sp|Q06831|SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus GN=Sox4 PE=1 SV=2 127 200 5.0E-06
sp|Q06945|SOX4_HUMAN Transcription factor SOX-4 OS=Homo sapiens GN=SOX4 PE=1 SV=1 112 200 6.0E-06
sp|B1H349|SOX6_XENTR Transcription factor Sox-6 OS=Xenopus tropicalis GN=sox6 PE=2 SV=1 124 199 6.0E-06
sp|P35712|SOX6_HUMAN Transcription factor SOX-6 OS=Homo sapiens GN=SOX6 PE=1 SV=3 124 199 6.0E-06
sp|P40645|SOX6_MOUSE Transcription factor SOX-6 OS=Mus musculus GN=Sox6 PE=1 SV=2 124 199 6.0E-06
sp|Q5RCU4|SOX6_PONAB Transcription factor SOX-6 OS=Pongo abelii GN=SOX6 PE=2 SV=1 124 199 7.0E-06
sp|Q6IZ48|SOX8_TETNG Transcription factor Sox-8 OS=Tetraodon nigroviridis GN=sox8 PE=2 SV=2 122 220 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5042
MSFADNVAQQWDVLYLEALWSGLQGQINPFGQVLCLEGPVYRSLHDGARDYIANKFMQHIGQSVIYVLDGNGPDR
VYLGAPRHFLAGSGKIFCLPGDKLYWTRDYGAHKINVDEPSSNPEPKKEATIRRPPNAYILYRKERHHLVKNSNP
KITNNEISQILGKAWNLETPEIRLKYKIMSDDLKKALLEKHPDYQYRPRRPSERRRRRRNQKQPEDNDAGPDGAS
TSTADVVDGGSSANEDHFHGSTDFESAMNEFTNAF*
Coding >OphauB2|5042
ATGTCTTTTGCAGACAACGTTGCTCAGCAATGGGATGTTCTCTACCTAGAGGCCCTCTGGAGCGGACTTCAGGGA
CAAATCAATCCTTTTGGTCAAGTACTCTGTCTCGAGGGCCCTGTCTACCGTTCGCTTCACGATGGTGCTAGGGAC
TACATTGCCAACAAATTCATGCAACACATTGGGCAATCAGTCATCTACGTGTTAGATGGTAATGGACCTGACCGT
GTCTATCTCGGAGCACCTCGCCACTTTCTCGCGGGCTCCGGCAAAATATTTTGTCTTCCAGGAGACAAACTGTAC
TGGACACGGGACTATGGCGCTCACAAGATAAATGTTGATGAGCCTTCATCAAATCCTGAGCCTAAGAAAGAAGCC
ACCATTCGTCGGCCCCCGAATGCCTATATTCTCTATCGCAAAGAGCGCCATCATCTAGTCAAGAACTCGAACCCC
AAGATCACAAACAATGAGATCTCACAAATCCTCGGAAAAGCCTGGAATCTAGAGACTCCCGAGATTAGACTCAAG
TACAAGATCATGTCTGATGATCTCAAGAAGGCTCTGCTTGAGAAGCATCCTGACTATCAATATCGACCTCGTCGA
CCATCTGAGCGCCGACGCCGTCGACGCAATCAGAAGCAGCCCGAAGACAATGATGCAGGCCCCGATGGGGCTTCT
ACAAGTACCGCTGACGTGGTGGACGGTGGCTCGAGTGCTAATGAAGATCATTTCCATGGCAGCACAGACTTTGAA
TCCGCCATGAATGAGTTTACTAATGCTTTCTGA
Transcript >OphauB2|5042
ATGTCTTTTGCAGACAACGTTGCTCAGCAATGGGATGTTCTCTACCTAGAGGCCCTCTGGAGCGGACTTCAGGGA
CAAATCAATCCTTTTGGTCAAGTACTCTGTCTCGAGGGCCCTGTCTACCGTTCGCTTCACGATGGTGCTAGGGAC
TACATTGCCAACAAATTCATGCAACACATTGGGCAATCAGTCATCTACGTGTTAGATGGTAATGGACCTGACCGT
GTCTATCTCGGAGCACCTCGCCACTTTCTCGCGGGCTCCGGCAAAATATTTTGTCTTCCAGGAGACAAACTGTAC
TGGACACGGGACTATGGCGCTCACAAGATAAATGTTGATGAGCCTTCATCAAATCCTGAGCCTAAGAAAGAAGCC
ACCATTCGTCGGCCCCCGAATGCCTATATTCTCTATCGCAAAGAGCGCCATCATCTAGTCAAGAACTCGAACCCC
AAGATCACAAACAATGAGATCTCACAAATCCTCGGAAAAGCCTGGAATCTAGAGACTCCCGAGATTAGACTCAAG
TACAAGATCATGTCTGATGATCTCAAGAAGGCTCTGCTTGAGAAGCATCCTGACTATCAATATCGACCTCGTCGA
CCATCTGAGCGCCGACGCCGTCGACGCAATCAGAAGCAGCCCGAAGACAATGATGCAGGCCCCGATGGGGCTTCT
ACAAGTACCGCTGACGTGGTGGACGGTGGCTCGAGTGCTAATGAAGATCATTTCCATGGCAGCACAGACTTTGAA
TCCGCCATGAATGAGTTTACTAATGCTTTCTGA
Gene >OphauB2|5042
ATGTCTTTTGCAGACAACGTTGCTCAGCAATGGGATGTTCTCTACCTAGAGGCCCTCTGGAGCGGACTTCAGGGA
CAAATCAATCCTTTTGGTCAAGTACTCTGTCTCGAGGGCCCTGTCTACCGTTCGCTTCACGATGGTGCTAGGGAC
TACATTGCCAACAAATTCATGTTTGTTCATCTTTCCACTCTGATCATTCTGTTGCTAACTAGCTTGACAGGCAAC
ACATTGGGCAATCAGTCATCTACGTGTTAGATGGTAATGGACCTGACCGTGTCTATCTCGGAGCACCTCGCCACT
TTCTCGCGGGCTCCGGCAAAATATTTTGTCTTCCAGGAGACAAACTGTACTGGACACGGGACTATGGCGCTCACA
AGATAAATGTTGATGAGCCTTCATCAAATCCTGAGCCTAAGAAAGAAGCCACCATTCGTCGGCCCCCGAATGCCT
ATATTCTCTATCGCAAAGAGCGCCATCATCTAGTCAAGAACTCGAACCCCAAGATCACAAACAATGAGATCTGTA
GGCTTTTTTTTTTAAGAATTTCTGTATTTCGCACTTTAAAAGTCCTTGATTTTGCTAACTTTCAGAAGCACAAAT
CCTCGGAAAAGCCTGGAATCTAGAGACTCCCGAGATTAGACTCAAGTACAAGATCATGTCTGATGATCTCAAGAA
GGCTCTGCTTGAGAAGCATCCTGACTATCAATATCGACCTCGTCGACCATCTGAGCGCCGACGCCGTCGACGCAA
TCAGAAGCAGCCCGAAGACAATGATGCAGGCCCCGATGGGGCTTCTACAAGTACCGCTGACGTGGTGGACGGTGG
CTCGAGTGCTAATGAAGATCATTTCCATGGCAGCACAGACTTTGAATCCGCCATGAATGAGTTTACTAATGCTTT
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail