Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5041
Gene name
LocationContig_37:23948..24693
Strand+
Gene length (bp)745
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 5.6E-12 88 135

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08143|SMR2_PODAS Sporulation minus regulator 2 OS=Podospora anserina GN=SMR2 PE=3 SV=1 78 136 2.0E-08
sp|P36981|MATB_NEUCS Mating-type protein a-1 OS=Neurospora crassa GN=mta-1 PE=1 SV=2 85 129 2.0E-07
sp|P35693|FPR1_PODAS MAT+ sexual cell fertilization-promoting factor OS=Podospora anserina GN=FPR1 PE=3 SV=2 76 141 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5041
MEVQAFVPASFDLEVVKKIAANFSRRVREPVKVFYDDKRHKYRLCPLPDGHQRNISSYGIYCFEVDVEASQSPPA
HEQATFGGSKSHIPRPRNSWILYRQHKYAEIKDQYPGLTAPALSTIIASMWRNESTDDKAYIAKRAPTKGLKRRS
DQMAN*
Coding >OphauB2|5041
ATGGAAGTGCAAGCTTTTGTGCCAGCTAGCTTTGATCTTGAAGTTGTCAAGAAAATTGCCGCAAATTTCAGTCGT
CGCGTGCGGGAGCCTGTCAAGGTGTTTTATGACGACAAGCGTCACAAGTACAGGCTCTGTCCTCTTCCAGATGGC
CACCAGAGAAACATTTCAAGCTATGGAATTTACTGTTTCGAAGTTGATGTTGAAGCGTCTCAGTCACCACCTGCT
CATGAGCAGGCTACATTTGGCGGAAGCAAAAGCCACATACCACGTCCACGAAACAGCTGGATTCTATATCGCCAG
CACAAATATGCGGAAATAAAGGACCAGTATCCGGGATTGACCGCACCAGCACTCTCTACTATCATTGCCTCGATG
TGGAGAAACGAATCTACAGATGATAAAGCGTATATTGCCAAACGAGCACCCACCAAGGGCTTGAAGCGAAGGTCG
GATCAAATGGCAAACTGA
Transcript >OphauB2|5041
ATGGAAGTGCAAGCTTTTGTGCCAGCTAGCTTTGATCTTGAAGTTGTCAAGAAAATTGCCGCAAATTTCAGTCGT
CGCGTGCGGGAGCCTGTCAAGGTGTTTTATGACGACAAGCGTCACAAGTACAGGCTCTGTCCTCTTCCAGATGGC
CACCAGAGAAACATTTCAAGCTATGGAATTTACTGTTTCGAAGTTGATGTTGAAGCGTCTCAGTCACCACCTGCT
CATGAGCAGGCTACATTTGGCGGAAGCAAAAGCCACATACCACGTCCACGAAACAGCTGGATTCTATATCGCCAG
CACAAATATGCGGAAATAAAGGACCAGTATCCGGGATTGACCGCACCAGCACTCTCTACTATCATTGCCTCGATG
TGGAGAAACGAATCTACAGATGATAAAGCGTATATTGCCAAACGAGCACCCACCAAGGGCTTGAAGCGAAGGTCG
GATCAAATGGCAAACTGA
Gene >OphauB2|5041
ATGGAAGTGCAAGCTTTTGTGCCAGCTAGCTTTGATCTTGAAGTTGTCAAGAAAATTGCCGCAAATTTCAGGTAA
GTGTCAAAGCAATCATCTTGTCGACTAGGATCCTGACGAGTCGCAGTCGTCGCGTGCGGGAGCCTGTCAAGGTGT
TTTATGACGACAAGCGTCACAAGTACAGGCTCTGTCCTCTTCCAGATGGCCACCAGAGAAACATTTCAAGCTATG
GAATTTACTGTTTCGAAGTTGGTACGAGTTGATTGCCTATTGCGTATTCGATTGAACAGACTGACTGACTCAGGC
AAGATGTTGAAGCGTCTCAGTCACCACCTGCTCATGAGCAGGCTACATTTGGCGGAAGCAAAAGCCACATACCAC
GTCCACGAAACAGCTGGATTCTATATCGCCAGCACAAATATGCGGAAATAAAGGACCAGTATCCGGGATTGACCG
CACCAGCACTCTGTCAGTTTTCAAGCCGCGGTTCCTTGGCCATTGCTGACTTGTTCAAGCTACTATCATTGCCTC
GATGTGGAGAAACGAATCTACAGATGATAAAGCGTATTGGCAACAGAAATCGAGAGAGGAAGACCGTTTACACAA
AAAAAAAATCCAAGCTACAGGTATATTGCCAAACGAGCACCCACCAAGGGCTTGAAGCGAAGGTCGGATCAAATG
GCAGTAAGTAGAACTCTGCAAACACTACTCATCAAATACAGACCACTCAATTCAACTGCCACAGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail