Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5032
Gene name
LocationContig_37:1806..3615
Strand-
Gene length (bp)1809
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05920 Homeobox_KN Homeobox KN domain 2.4E-15 305 344
PF00046 Homeodomain Homeodomain 4.3E-07 299 346

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O46339|HTH_DROME Homeobox protein homothorax OS=Drosophila melanogaster GN=hth PE=1 SV=1 264 365 2.0E-11
sp|A6NDR6|ME3L1_HUMAN Putative homeobox protein Meis3-like 1 OS=Homo sapiens GN=MEIS3P1 PE=5 SV=2 275 357 5.0E-10
sp|P97368|MEIS3_MOUSE Homeobox protein Meis3 OS=Mus musculus GN=Meis3 PE=2 SV=2 275 364 6.0E-10
sp|P48731|ATH1_ARATH Homeobox protein ATH1 OS=Arabidopsis thaliana GN=ATH1 PE=1 SV=1 297 344 9.0E-10
sp|Q99687|MEIS3_HUMAN Homeobox protein Meis3 OS=Homo sapiens GN=MEIS3 PE=2 SV=3 275 357 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O46339|HTH_DROME Homeobox protein homothorax OS=Drosophila melanogaster GN=hth PE=1 SV=1 264 365 2.0E-11
sp|A6NDR6|ME3L1_HUMAN Putative homeobox protein Meis3-like 1 OS=Homo sapiens GN=MEIS3P1 PE=5 SV=2 275 357 5.0E-10
sp|P97368|MEIS3_MOUSE Homeobox protein Meis3 OS=Mus musculus GN=Meis3 PE=2 SV=2 275 364 6.0E-10
sp|P48731|ATH1_ARATH Homeobox protein ATH1 OS=Arabidopsis thaliana GN=ATH1 PE=1 SV=1 297 344 9.0E-10
sp|Q99687|MEIS3_HUMAN Homeobox protein Meis3 OS=Homo sapiens GN=MEIS3 PE=2 SV=3 275 357 1.0E-09
sp|A8WL06|UNC62_CAEBR Homeobox protein unc-62 OS=Caenorhabditis briggsae GN=unc-62 PE=3 SV=2 281 354 2.0E-09
sp|Q9SW80|BLH2_ARATH BEL1-like homeodomain protein 2 OS=Arabidopsis thaliana GN=BLH2 PE=1 SV=3 297 344 2.0E-09
sp|Q5R6L1|PKNX2_PONAB Homeobox protein PKNOX2 OS=Pongo abelii GN=PKNOX2 PE=2 SV=1 272 381 3.0E-09
sp|Q96KN3|PKNX2_HUMAN Homeobox protein PKNOX2 OS=Homo sapiens GN=PKNOX2 PE=2 SV=2 272 381 3.0E-09
sp|Q8BG99|PKNX2_MOUSE Homeobox protein PKNOX2 OS=Mus musculus GN=Pknox2 PE=2 SV=1 272 381 3.0E-09
sp|Q38897|BEL1_ARATH Homeobox protein BEL1 homolog OS=Arabidopsis thaliana GN=BEL1 PE=1 SV=2 297 344 3.0E-09
sp|Q9SJJ3|BLH8_ARATH BEL1-like homeodomain protein 8 OS=Arabidopsis thaliana GN=BLH8 PE=1 SV=1 297 357 5.0E-09
sp|Q9N5D6|UNC62_CAEEL Homeobox protein unc-62 OS=Caenorhabditis elegans GN=unc-62 PE=1 SV=1 281 354 5.0E-09
sp|Q5U4X3|MEI3A_XENLA Homeobox protein meis3-A OS=Xenopus laevis GN=meis3-a PE=2 SV=1 288 363 5.0E-09
sp|Q9SJ56|BLH1_ARATH BEL1-like homeodomain protein 1 OS=Arabidopsis thaliana GN=BLH1 PE=1 SV=1 297 344 5.0E-09
sp|Q6DIF3|MEIS3_XENTR Homeobox protein meis3 OS=Xenopus tropicalis GN=meis3 PE=2 SV=2 288 363 5.0E-09
sp|Q7ZY13|MEI3B_XENLA Homeobox protein meis3-B OS=Xenopus laevis GN=meis3-b PE=2 SV=2 288 363 6.0E-09
sp|Q9LZM8|BLH9_ARATH BEL1-like homeodomain protein 9 OS=Arabidopsis thaliana GN=BLH9 PE=1 SV=1 297 353 7.0E-09
sp|Q8SR09|HD2_ENCCU Homeobox protein HD-2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HD-2 PE=3 SV=1 265 344 9.0E-09
sp|A8K0S8|ME3L2_HUMAN Putative homeobox protein Meis3-like 2 OS=Homo sapiens GN=MEIS3P2 PE=2 SV=1 275 357 9.0E-09
sp|P79937|MEIS1_XENLA Homeobox protein Meis1 OS=Xenopus laevis GN=meis1 PE=1 SV=1 299 363 1.0E-08
sp|P97367|MEIS2_MOUSE Homeobox protein Meis2 OS=Mus musculus GN=Meis2 PE=1 SV=2 299 357 1.0E-08
sp|O14770|MEIS2_HUMAN Homeobox protein Meis2 OS=Homo sapiens GN=MEIS2 PE=1 SV=2 299 357 1.0E-08
sp|Q60954|MEIS1_MOUSE Homeobox protein Meis1 OS=Mus musculus GN=Meis1 PE=1 SV=1 299 363 1.0E-08
sp|O00470|MEIS1_HUMAN Homeobox protein Meis1 OS=Homo sapiens GN=MEIS1 PE=1 SV=1 299 363 1.0E-08
sp|Q94KL5|BLH4_ARATH BEL1-like homeodomain protein 4 OS=Arabidopsis thaliana GN=BLH4 PE=1 SV=2 297 344 1.0E-08
sp|Q8SRR1|HD12_ENCCU Homeobox protein HD-12 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HD-12 PE=3 SV=1 291 344 3.0E-08
sp|Q9SIW1|BLH7_ARATH BEL1-like homeodomain protein 7 OS=Arabidopsis thaliana GN=BLH7 PE=2 SV=1 301 344 6.0E-08
sp|Q6DHF9|SIX1A_DANRE Homeobox protein six1a OS=Danio rerio GN=six1a PE=2 SV=2 281 414 7.0E-08
sp|O65685|BLH6_ARATH BEL1-like homeodomain protein 6 OS=Arabidopsis thaliana GN=BLH6 PE=1 SV=1 301 344 7.0E-08
sp|Q8S897|BLH5_ARATH BEL1-like homeodomain protein 5 OS=Arabidopsis thaliana GN=BLH5 PE=1 SV=2 297 344 7.0E-08
sp|Q2HJ84|PKNX1_BOVIN Homeobox protein PKNOX1 OS=Bos taurus GN=PKNOX1 PE=2 SV=1 299 378 2.0E-07
sp|O70477|PKNX1_MOUSE Homeobox protein PKNOX1 OS=Mus musculus GN=Pknox1 PE=1 SV=3 299 356 3.0E-07
sp|P55347|PKNX1_HUMAN Homeobox protein PKNOX1 OS=Homo sapiens GN=PKNOX1 PE=1 SV=3 299 356 3.0E-07
sp|Q93348|IRX_CAEEL Putative iroquois-class homeodomain protein irx-1 OS=Caenorhabditis elegans GN=irx-1 PE=3 SV=3 280 344 4.0E-07
sp|Q99NE9|PBX4_MOUSE Pre-B-cell leukemia transcription factor 4 OS=Mus musculus GN=Pbx4 PE=2 SV=2 299 361 5.0E-07
sp|P70284|TGIF1_MOUSE Homeobox protein TGIF1 OS=Mus musculus GN=Tgif1 PE=1 SV=2 279 344 5.0E-07
sp|Q9FXG8|BLH10_ARATH BEL1-like homeodomain protein 10 OS=Arabidopsis thaliana GN=BLH10 PE=1 SV=1 301 344 6.0E-07
sp|Q1PFD1|BLH11_ARATH BEL1-like homeodomain protein 11 OS=Arabidopsis thaliana GN=BLH11 PE=2 SV=1 301 344 8.0E-07
sp|Q9BYU1|PBX4_HUMAN Pre-B-cell leukemia transcription factor 4 OS=Homo sapiens GN=PBX4 PE=1 SV=2 299 361 9.0E-07
sp|Q19503|HM40_CAEEL Homeobox protein ceh-40 OS=Caenorhabditis elegans GN=ceh-40 PE=1 SV=1 299 346 1.0E-06
sp|Q8MIB8|TF2LX_PONPY Homeobox protein TGIF2LX OS=Pongo pygmaeus GN=TGIF2LX PE=2 SV=1 289 344 1.0E-06
sp|Q54VB4|HBX9_DICDI Homeobox protein 9 OS=Dictyostelium discoideum GN=hbx9 PE=3 SV=1 259 344 1.0E-06
sp|Q90655|AKR_CHICK Homeobox protein AKR OS=Gallus gallus PE=2 SV=1 279 344 2.0E-06
sp|Q15583|TGIF1_HUMAN Homeobox protein TGIF1 OS=Homo sapiens GN=TGIF1 PE=1 SV=3 279 344 2.0E-06
sp|Q5IS58|TGIF1_PANTR Homeobox protein TGIF1 OS=Pan troglodytes GN=TGIF1 PE=2 SV=1 279 344 2.0E-06
sp|Q38874|STM_ARATH Homeobox protein SHOOT MERISTEMLESS OS=Arabidopsis thaliana GN=STM PE=1 SV=2 300 371 2.0E-06
sp|P41817|CUP9_YEAST Homeobox protein CUP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUP9 PE=1 SV=1 290 391 2.0E-06
sp|Q27350|SO_DROME Protein sine oculis OS=Drosophila melanogaster GN=so PE=2 SV=1 281 348 3.0E-06
sp|A2D5H2|SIX1_LAGLA Homeobox protein SIX1 OS=Lagothrix lagotricha GN=SIX1 PE=3 SV=1 281 348 3.0E-06
sp|Q15475|SIX1_HUMAN Homeobox protein SIX1 OS=Homo sapiens GN=SIX1 PE=1 SV=1 281 348 3.0E-06
sp|A1YER0|SIX1_GORGO Homeobox protein SIX1 OS=Gorilla gorilla gorilla GN=SIX1 PE=3 SV=1 281 348 3.0E-06
sp|Q9I8H0|SIX1_XENLA Homeobox protein six1 OS=Xenopus laevis GN=six1 PE=2 SV=1 281 348 3.0E-06
sp|Q62231|SIX1_MOUSE Homeobox protein SIX1 OS=Mus musculus GN=Six1 PE=1 SV=2 281 348 3.0E-06
sp|Q8MID6|TF2LX_MACMU Homeobox protein TGIF2LX OS=Macaca mulatta GN=TGIF2LX PE=2 SV=1 299 357 3.0E-06
sp|Q9NPC8|SIX2_HUMAN Homeobox protein SIX2 OS=Homo sapiens GN=SIX2 PE=1 SV=1 281 348 4.0E-06
sp|Q62232|SIX2_MOUSE Homeobox protein SIX2 OS=Mus musculus GN=Six2 PE=1 SV=2 281 348 4.0E-06
sp|Q9M6D9|STM_BRAOL Homeobox protein SHOOT MERISTEMLESS OS=Brassica oleracea GN=STM PE=2 SV=1 300 370 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0031323 regulation of cellular metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Homeodomain

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5032
MVEVLGQRQMMAHNDQGVAADACWEGAGGSELDWTDVFLLANDDPYAHPCDSYASYDGGVDLGLSVGAGAEGGDD
AGVFGVLRQQQQQQQQQQQQQQQPPVWATSGSGSGSGLGSGPGPGPGSGSGSGWGGCGRARPRLEQAAGEQQAAA
VGQQQQQQTLNEECQQHQQQQAAAVGQHQQHQQAAAAIGAHPPEKLGMAEFFTKNNAWRPPLPCSHCRRLRLQCF
MLQTTPANPNPVNSCSSCVALFRQCSLAERCKRQPCLFETSSPVIGQLHGVNEELDGAAASCNKRASSRAVRKTQ
VLRDWFACNLAHPYPSDQDKNILALESGLSRTQVVNWFTNARRRHRLATQPMVNNATFPTGSPMPRSLLSSMTPM
ERWRNSPPESEHISASAIQRALDTAVPALDLPALVLPVPPQPAPPVHVGSSASGDSLCYAPSMQNCSIYSSEGSA
DSSRLSANSDSTALSAQSTADSTAKTRRCKPRHFPCRHCPRTFSKKYDWIRHERCLHDAGNVSWICALPLRPNQP
FVIWRLGQDRSECILCGTPSPTQEHFHSHEFDACSRRSVQHRSFSRKDHLWQHLYKFHGCRKWDGWKPDLTLLQH
GA*
Coding >OphauB2|5032
ATGGTCGAGGTGCTTGGCCAGCGACAAATGATGGCTCACAATGATCAGGGCGTTGCAGCTGACGCTTGCTGGGAG
GGCGCTGGGGGAAGTGAGCTGGACTGGACTGACGTGTTCCTGCTGGCAAACGACGACCCCTACGCCCATCCTTGC
GACTCTTATGCCTCTTACGACGGCGGCGTGGACCTGGGCCTGAGCGTGGGAGCAGGAGCCGAGGGCGGCGACGAT
GCGGGCGTGTTTGGGGTTTTGCGGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAACAGCAGCAGCCGCCA
GTGTGGGCGACGTCAGGCTCAGGTTCAGGCTCAGGCTTAGGCTCAGGCCCAGGCCCAGGCCCAGGCTCGGGCTCG
GGCTCGGGCTGGGGGGGCTGCGGGCGGGCTCGGCCTCGGCTTGAGCAGGCAGCAGGCGAGCAGCAGGCGGCAGCA
GTAGGACAGCAGCAGCAGCAGCAGACACTAAACGAGGAGTGTCAGCAGCACCAGCAGCAGCAGGCGGCAGCAGTA
GGACAGCACCAGCAGCACCAGCAGGCGGCAGCAGCCATAGGGGCGCATCCGCCCGAAAAACTAGGCATGGCAGAA
TTCTTCACCAAAAACAACGCCTGGCGCCCTCCCTTGCCCTGCTCGCACTGCCGGCGCCTGCGCTTGCAATGCTTC
ATGCTGCAGACGACGCCGGCAAACCCAAACCCCGTCAACTCGTGCTCGAGCTGCGTGGCGCTCTTCCGGCAGTGC
AGCCTGGCAGAGCGCTGCAAGCGGCAGCCCTGCCTGTTTGAGACGTCGTCGCCCGTCATCGGCCAGCTGCACGGC
GTCAATGAAGAGCTCGACGGCGCCGCTGCCTCGTGCAACAAGCGGGCCAGCTCGCGCGCCGTGCGCAAGACGCAG
GTGCTGCGCGACTGGTTTGCCTGCAACCTGGCGCACCCGTACCCGTCGGACCAAGATAAAAACATTCTCGCCCTC
GAGTCGGGCCTCAGCCGAACGCAGGTGGTGAATTGGTTCACCAATGCCCGCCGCCGCCACCGCCTCGCCACCCAG
CCCATGGTCAACAATGCCACCTTTCCCACCGGCTCCCCCATGCCTCGCTCCCTGCTGTCCAGCATGACGCCCATG
GAGCGCTGGCGCAACTCGCCCCCTGAAAGCGAGCACATCTCGGCCTCGGCCATCCAGCGTGCCCTCGACACGGCT
GTGCCCGCCCTCGACCTGCCTGCCCTGGTGCTGCCTGTGCCGCCCCAGCCTGCCCCGCCTGTCCATGTCGGCTCC
TCGGCCAGCGGCGACTCGCTCTGCTACGCCCCCTCGATGCAAAACTGCTCCATCTACTCTTCCGAGGGCTCTGCC
GACTCGTCGCGCCTCTCGGCCAATAGCGACTCGACGGCCCTGTCTGCCCAGAGCACAGCAGACTCGACGGCCAAG
ACGCGCCGCTGCAAGCCACGCCACTTCCCCTGTCGCCACTGTCCGCGCACCTTTTCCAAAAAGTACGACTGGATT
CGCCACGAGCGCTGCCTCCACGACGCCGGCAACGTCTCGTGGATATGCGCCCTCCCTCTGCGCCCCAACCAGCCC
TTTGTCATCTGGCGCCTGGGCCAGGACCGCTCCGAGTGTATTCTCTGCGGCACCCCCTCGCCCACCCAGGAGCAT
TTCCACTCGCACGAGTTTGACGCCTGCTCGCGACGCTCCGTCCAGCATCGCAGCTTCTCCCGCAAGGACCACTTG
TGGCAGCATCTCTACAAGTTCCACGGCTGTCGCAAATGGGACGGCTGGAAGCCCGACTTGACCCTGCTCCAGCAC
GGCGCCTGA
Transcript >OphauB2|5032
ATGGTCGAGGTGCTTGGCCAGCGACAAATGATGGCTCACAATGATCAGGGCGTTGCAGCTGACGCTTGCTGGGAG
GGCGCTGGGGGAAGTGAGCTGGACTGGACTGACGTGTTCCTGCTGGCAAACGACGACCCCTACGCCCATCCTTGC
GACTCTTATGCCTCTTACGACGGCGGCGTGGACCTGGGCCTGAGCGTGGGAGCAGGAGCCGAGGGCGGCGACGAT
GCGGGCGTGTTTGGGGTTTTGCGGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAACAGCAGCAGCCGCCA
GTGTGGGCGACGTCAGGCTCAGGTTCAGGCTCAGGCTTAGGCTCAGGCCCAGGCCCAGGCCCAGGCTCGGGCTCG
GGCTCGGGCTGGGGGGGCTGCGGGCGGGCTCGGCCTCGGCTTGAGCAGGCAGCAGGCGAGCAGCAGGCGGCAGCA
GTAGGACAGCAGCAGCAGCAGCAGACACTAAACGAGGAGTGTCAGCAGCACCAGCAGCAGCAGGCGGCAGCAGTA
GGACAGCACCAGCAGCACCAGCAGGCGGCAGCAGCCATAGGGGCGCATCCGCCCGAAAAACTAGGCATGGCAGAA
TTCTTCACCAAAAACAACGCCTGGCGCCCTCCCTTGCCCTGCTCGCACTGCCGGCGCCTGCGCTTGCAATGCTTC
ATGCTGCAGACGACGCCGGCAAACCCAAACCCCGTCAACTCGTGCTCGAGCTGCGTGGCGCTCTTCCGGCAGTGC
AGCCTGGCAGAGCGCTGCAAGCGGCAGCCCTGCCTGTTTGAGACGTCGTCGCCCGTCATCGGCCAGCTGCACGGC
GTCAATGAAGAGCTCGACGGCGCCGCTGCCTCGTGCAACAAGCGGGCCAGCTCGCGCGCCGTGCGCAAGACGCAG
GTGCTGCGCGACTGGTTTGCCTGCAACCTGGCGCACCCGTACCCGTCGGACCAAGATAAAAACATTCTCGCCCTC
GAGTCGGGCCTCAGCCGAACGCAGGTGGTGAATTGGTTCACCAATGCCCGCCGCCGCCACCGCCTCGCCACCCAG
CCCATGGTCAACAATGCCACCTTTCCCACCGGCTCCCCCATGCCTCGCTCCCTGCTGTCCAGCATGACGCCCATG
GAGCGCTGGCGCAACTCGCCCCCTGAAAGCGAGCACATCTCGGCCTCGGCCATCCAGCGTGCCCTCGACACGGCT
GTGCCCGCCCTCGACCTGCCTGCCCTGGTGCTGCCTGTGCCGCCCCAGCCTGCCCCGCCTGTCCATGTCGGCTCC
TCGGCCAGCGGCGACTCGCTCTGCTACGCCCCCTCGATGCAAAACTGCTCCATCTACTCTTCCGAGGGCTCTGCC
GACTCGTCGCGCCTCTCGGCCAATAGCGACTCGACGGCCCTGTCTGCCCAGAGCACAGCAGACTCGACGGCCAAG
ACGCGCCGCTGCAAGCCACGCCACTTCCCCTGTCGCCACTGTCCGCGCACCTTTTCCAAAAAGTACGACTGGATT
CGCCACGAGCGCTGCCTCCACGACGCCGGCAACGTCTCGTGGATATGCGCCCTCCCTCTGCGCCCCAACCAGCCC
TTTGTCATCTGGCGCCTGGGCCAGGACCGCTCCGAGTGTATTCTCTGCGGCACCCCCTCGCCCACCCAGGAGCAT
TTCCACTCGCACGAGTTTGACGCCTGCTCGCGACGCTCCGTCCAGCATCGCAGCTTCTCCCGCAAGGACCACTTG
TGGCAGCATCTCTACAAGTTCCACGGCTGTCGCAAATGGGACGGCTGGAAGCCCGACTTGACCCTGCTCCAGCAC
GGCGCCTGA
Gene >OphauB2|5032
ATGGTCGAGGTGCTTGGCCAGCGACAAATGATGGCTCACAATGATCAGGGCGTTGCAGCTGACGCTTGCTGGGAG
GGCGCTGGGGGAAGTGAGCTGGACTGGACTGACGTGTTCCTGCTGGCAAACGACGACCCCTACGCCCATCCTTGC
GACTCTTATGCCTCTTACGACGGCGGCGTGGACCTGGGCCTGAGCGTGGGAGCAGGAGCCGAGGGCGGCGACGAT
GCGGGCGTGTTTGGGGTTTTGCGGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAACAGCAGCAGCCGCCA
GTGTGGGCGACGTCAGGCTCAGGTTCAGGCTCAGGCTTAGGCTCAGGCCCAGGCCCAGGCCCAGGCTCGGGCTCG
GGCTCGGGCTGGGGGGGCTGCGGGCGGGCTCGGCCTCGGCTTGAGCAGGCAGCAGGCGAGCAGCAGGCGGCAGCA
GTAGGACAGCAGCAGCAGCAGCAGACACTAAACGAGGAGTGTCAGCAGCACCAGCAGCAGCAGGCGGCAGCAGTA
GGACAGCACCAGCAGCACCAGCAGGCGGCAGCAGCCATAGGGGCGCATCCGCCCGAAAAACTAGGCATGGCAGAA
TTCTTCACCAAAAACAACGCCTGGCGCCCTCCCTTGCCCTGCTCGCACTGCCGGCGCCTGCGCTTGCAATGCTTC
ATGCTGCAGACGACGCCGGCAAACCCAAACCCCGTCAACTCGTGCTCGAGCTGCGTGGCGCTCTTCCGGCAGTGC
AGCCTGGCAGAGCGCTGCAAGCGGCAGCCCTGCCTGTTTGAGACGTCGTCGCCCGTCATCGGCCAGCTGCACGGC
GTCAATGAAGAGCTCGACGGCGCCGCTGCCTCGTGCAACAAGCGGGCCAGCTCGCGCGCCGTGCGCAAGACGCAG
GTGCTGCGCGACTGGTTTGCCTGCAACCTGGCGCACCCGTACCCGTCGGACCAAGATAAAAACATTCTCGCCCTC
GAGTCGGGCCTCAGCCGAACGCAGGTGGTGAATTGGTTCACCAATGCCCGCCGCCGCCACCGCCTCGCCACCCAG
CCCATGGTCAACAATGCCACCTTTCCCACCGGCTCCCCCATGCCTCGCTCCCTGCTGTCCAGCATGACGCCCATG
GAGCGCTGGCGCAACTCGCCCCCTGAAAGCGAGCACATCTCGGCCTCGGCCATCCAGCGTGCCCTCGACACGGCT
GTGCCCGCCCTCGACCTGCCTGCCCTGGTGCTGCCTGTGCCGCCCCAGCCTGCCCCGCCTGTCCATGTCGGCTCC
TCGGCCAGCGGCGACTCGCTCTGCTACGCCCCCTCGATGCAAAACTGCTCCATCTACTCTTCCGAGGGCTCTGCC
GACTCGTCGCGCCTCTCGGCCAATAGCGACTCGACGGCCCTGTCTGCCCAGAGCACAGCAGACTCGACGGCCAAG
ACGCGCCGCTGCAAGCCACGCCACTTCCCCTGTCGCCACTGTCCGCGCACCTTTTCCAAAAAGTACGACTGGATT
CGCCACGAGCGCTGCCTCCACGACGCCGGCAACGTCTCGTGGATATGCGCCCTCCCTCTGCGCCCCAACCAGCCC
TTTGTCATCTGGCGCCTGGGCCAGGACCGCTCCGAGTGTATTCTCTGCGGCACCCCCTCGCCCACCCAGGAGCAT
TTCCACTCGCACGAGTTTGACGCCTGCTCGCGACGCTCCGTCCAGCATCGCAGCTTCTCCCGCAAGGACCACTTG
TGGCAGCATCTCTACAAGTTCCACGGCTGTCGCAAATGGGACGGCTGGAAGCCCGACTTGACCCTGCTCCAGCAC
GGCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail