Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5024
Gene name
LocationContig_364:382..1505
Strand+
Gene length (bp)1123
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00125 Histone Core histone H2A/H2B/H3/H4 3.4E-16 81 151
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 5.8E-15 88 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02516|HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP5 PE=1 SV=1 51 166 3.0E-52
sp|P79007|HAP5_SCHPO Transcriptional activator hap5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap5 PE=2 SV=1 11 178 7.0E-50
sp|Q9FMV5|NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1 65 204 5.0E-44
sp|Q9SMP0|NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1 68 204 3.0E-43
sp|Q8LCG7|NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2 66 168 3.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02516|HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP5 PE=1 SV=1 51 166 3.0E-52
sp|P79007|HAP5_SCHPO Transcriptional activator hap5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap5 PE=2 SV=1 11 178 7.0E-50
sp|Q9FMV5|NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1 65 204 5.0E-44
sp|Q9SMP0|NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1 68 204 3.0E-43
sp|Q8LCG7|NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2 66 168 3.0E-42
sp|P70353|NFYC_MOUSE Nuclear transcription factor Y subunit gamma OS=Mus musculus GN=Nfyc PE=1 SV=2 66 183 3.0E-42
sp|Q5E9X1|NFYC_BOVIN Nuclear transcription factor Y subunit gamma OS=Bos taurus GN=NFYC PE=2 SV=1 66 183 3.0E-42
sp|Q62725|NFYC_RAT Nuclear transcription factor Y subunit gamma OS=Rattus norvegicus GN=Nfyc PE=2 SV=1 66 183 3.0E-42
sp|Q8L4B2|NFYC9_ARATH Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana GN=NFYC9 PE=2 SV=1 69 204 4.0E-42
sp|Q5RA23|NFYC_PONAB Nuclear transcription factor Y subunit gamma OS=Pongo abelii GN=NFYC PE=2 SV=1 66 183 4.0E-42
sp|Q9ZVL3|NFYC3_ARATH Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana GN=NFYC3 PE=2 SV=1 68 185 2.0E-41
sp|Q13952|NFYC_HUMAN Nuclear transcription factor Y subunit gamma OS=Homo sapiens GN=NFYC PE=1 SV=3 66 183 6.0E-41
sp|Q9FGP7|NFYC6_ARATH Nuclear transcription factor Y subunit C-6 OS=Arabidopsis thaliana GN=NFYC6 PE=2 SV=1 66 173 6.0E-38
sp|Q557I1|NFYC_DICDI Nuclear transcription factor Y subunit gamma OS=Dictyostelium discoideum GN=nfyc-1 PE=3 SV=1 58 168 2.0E-36
sp|Q4PSE2|NFYC8_ARATH Nuclear transcription factor Y subunit C-8 OS=Arabidopsis thaliana GN=NFYC8 PE=2 SV=1 66 180 2.0E-29
sp|Q9FGP6|NFYC5_ARATH Nuclear transcription factor Y subunit C-5 OS=Arabidopsis thaliana GN=NFYC5 PE=2 SV=1 66 169 1.0E-26
sp|Q9FGP8|NFYC7_ARATH Nuclear transcription factor Y subunit C-7 OS=Arabidopsis thaliana GN=NFYC7 PE=2 SV=1 83 167 3.0E-25
sp|Q58CM8|NFYCA_ARATH Nuclear transcription factor Y subunit C-10 OS=Arabidopsis thaliana GN=NFYC10 PE=2 SV=1 66 165 3.0E-23
sp|Q9CQ36|DPOE4_MOUSE DNA polymerase epsilon subunit 4 OS=Mus musculus GN=Pole4 PE=1 SV=1 84 160 2.0E-13
sp|Q9NR33|DPOE4_HUMAN DNA polymerase epsilon subunit 4 OS=Homo sapiens GN=POLE4 PE=1 SV=2 85 160 3.0E-13
sp|A6QQ14|DPOE4_BOVIN DNA polymerase epsilon subunit 4 OS=Bos taurus GN=POLE4 PE=3 SV=1 85 160 5.0E-13
sp|Q9NRG0|CHRC1_HUMAN Chromatin accessibility complex protein 1 OS=Homo sapiens GN=CHRAC1 PE=1 SV=1 85 171 8.0E-12
sp|Q9JKP8|CHRC1_MOUSE Chromatin accessibility complex protein 1 OS=Mus musculus GN=Chrac1 PE=1 SV=1 83 172 3.0E-11
sp|Q54DA1|NC2A_DICDI Dr1-associated corepressor homolog OS=Dictyostelium discoideum GN=drap1 PE=3 SV=1 88 175 2.0E-08
sp|C6Y4D0|YCGV_SCHPO Putative transcription factor C16C4.22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16C4.22 PE=3 SV=1 89 163 6.0E-08
sp|Q6BX14|DPB3_DEBHA DNA polymerase epsilon subunit C OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPB3 PE=3 SV=1 89 166 8.0E-08
sp|A0JPP1|NC2A_RAT Dr1-associated corepressor OS=Rattus norvegicus GN=Drap1 PE=2 SV=1 88 164 3.0E-07
sp|Q14919|NC2A_HUMAN Dr1-associated corepressor OS=Homo sapiens GN=DRAP1 PE=1 SV=3 88 164 3.0E-07
sp|Q2YDP3|NC2A_BOVIN Dr1-associated corepressor OS=Bos taurus GN=DRAP1 PE=2 SV=1 88 164 4.0E-07
sp|Q9D6N5|NC2A_MOUSE Dr1-associated corepressor OS=Mus musculus GN=Drap1 PE=1 SV=3 88 164 5.0E-07
sp|Q6C6M5|DPB3_YARLI DNA polymerase epsilon subunit C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPB3 PE=3 SV=1 88 199 3.0E-06
sp|Q10315|DPB3_SCHPO DNA polymerase epsilon subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpb3 PE=1 SV=1 88 166 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5125
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1033
Ophiocordyceps australis map64 (Brazil) OphauB2|5024 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04266
Ophiocordyceps camponoti-rufipedis Ophun1|343
Ophiocordyceps kimflemingae Ophio5|8494
Ophiocordyceps subramaniannii Hirsu2|3405

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5024
MEPPNQSAAQSHTQHNRPAPVYDPSQGGHYGACAALASQGFAPAELYTGPWANVHQGLTGQYKDILTTYWQQTIN
HLESDTHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDIFITELTMRAWIHAEENKRRTLQRSDIASA
LAKSDMFDFLIDIVPREEASSHAKRSAAQPAAPSAVTTASGQAQMPGQHAAMGQATNHASHSLDTADYMGSHHLA
ADQDYRQNPSMYPGQVPQPPSAPYGQAQAPPAMYGDMEGMYPYSAMQPQQAPMSSEEFE*
Coding >OphauB2|5024
ATGGAACCCCCAAATCAATCTGCCGCACAGTCGCACACTCAGCACAATCGGCCTGCGCCTGTTTATGACCCCAGC
CAAGGCGGCCATTATGGTGCATGCGCTGCCCTGGCTTCACAAGGCTTTGCTCCAGCAGAACTCTATACGGGACCT
TGGGCCAATGTTCACCAAGGTCTTACAGGGCAATACAAAGATATCCTGACAACCTACTGGCAGCAAACAATAAAT
CACCTCGAAAGTGATACTCATGATTACAAGATTCATCAGTTGCCTCTAGCGCGCATCAAAAAAGTCATGAAGGCC
GATCCAGAAGTCAAGATGATATCTGCCGAGGCACCCATTTTGTTTGCTAAAGGCTGTGACATTTTTATTACTGAG
CTTACTATGCGCGCTTGGATACACGCTGAGGAAAACAAGCGTCGCACGCTTCAACGCTCCGATATTGCTTCTGCT
CTCGCCAAGTCTGACATGTTTGACTTCCTCATCGACATTGTTCCACGAGAAGAGGCTTCCTCGCATGCGAAAAGG
AGTGCAGCTCAGCCTGCCGCCCCGTCAGCCGTTACTACCGCTTCAGGACAGGCCCAGATGCCCGGTCAGCACGCA
GCGATGGGCCAGGCTACCAACCACGCCTCTCATTCTCTCGACACCGCTGATTACATGGGAAGCCATCATCTTGCT
GCTGATCAGGACTACCGTCAAAACCCGAGCATGTATCCAGGACAGGTTCCACAGCCACCGTCGGCTCCATACGGC
CAAGCCCAGGCTCCACCAGCTATGTACGGAGACATGGAGGGCATGTATCCCTACTCTGCCATGCAGCCACAGCAG
GCACCCATGTCGTCAGAAGAATTCGAATAG
Transcript >OphauB2|5024
ATGGAACCCCCAAATCAATCTGCCGCACAGTCGCACACTCAGCACAATCGGCCTGCGCCTGTTTATGACCCCAGC
CAAGGCGGCCATTATGGTGCATGCGCTGCCCTGGCTTCACAAGGCTTTGCTCCAGCAGAACTCTATACGGGACCT
TGGGCCAATGTTCACCAAGGTCTTACAGGGCAATACAAAGATATCCTGACAACCTACTGGCAGCAAACAATAAAT
CACCTCGAAAGTGATACTCATGATTACAAGATTCATCAGTTGCCTCTAGCGCGCATCAAAAAAGTCATGAAGGCC
GATCCAGAAGTCAAGATGATATCTGCCGAGGCACCCATTTTGTTTGCTAAAGGCTGTGACATTTTTATTACTGAG
CTTACTATGCGCGCTTGGATACACGCTGAGGAAAACAAGCGTCGCACGCTTCAACGCTCCGATATTGCTTCTGCT
CTCGCCAAGTCTGACATGTTTGACTTCCTCATCGACATTGTTCCACGAGAAGAGGCTTCCTCGCATGCGAAAAGG
AGTGCAGCTCAGCCTGCCGCCCCGTCAGCCGTTACTACCGCTTCAGGACAGGCCCAGATGCCCGGTCAGCACGCA
GCGATGGGCCAGGCTACCAACCACGCCTCTCATTCTCTCGACACCGCTGATTACATGGGAAGCCATCATCTTGCT
GCTGATCAGGACTACCGTCAAAACCCGAGCATGTATCCAGGACAGGTTCCACAGCCACCGTCGGCTCCATACGGC
CAAGCCCAGGCTCCACCAGCTATGTACGGAGACATGGAGGGCATGTATCCCTACTCTGCCATGCAGCCACAGCAG
GCACCCATGTCGTCAGAAGAATTCGAATAG
Gene >OphauB2|5024
ATGGAACCCCCAAATCAATCTGCCGCACAGTCGCACACTCAGCACAATCGGCCTGCGCCTGTTTATGACCCCAGC
CAAGGCGGCCATTATGGTCAGTTGTATTGTACCCTGAAAGACTTATCGTATATTCTAACTGTCTTCAGGTGCATG
CGCTGCCGTATGTTTAAGTCTTCATTTGTCAATAGACCATATCATTCCCCCCCCCCATAAAAGAATAATAAAATA
TAGCTAATACCTTTTCTTCACTACGTTAGCTGGCTTCACAAGGCTTTGCTCCAGCAGAACTCTATACGGGACCTT
GGGCCAATGTTTGTTCTTGCCCCAGTGCTTGTCTCGTCATGTTTTATTGCTGACTGGCAACGCCCCAACAGGTTC
ACCAAGGTCTTACAGGGCAATACAAAGATATCCTGACAACCTACTGGCAGCAAACAATAAATCACCTCGAAAGTG
ATACTCATGATTACAAGATTCATCAGTTGCCTCTAGCGCGCATCAAAAAAGTCATGAAGGCCGATCCAGAAGTCA
AGATGATATCTGCCGAGGCACCCATTTTGTTTGCTAAAGGCTGTGACATTTTTATTACTGAGCTTACTATGCGCG
CTTGGATACACGCTGAGGAAAACAAGCGTCGCACGCTTCAACGCTCCGATATTGCTTCTGCTCTCGCCAAGTCTG
ACATGTTTGACTTCCTCATCGACATTGTTCCACGAGAAGAGGCTTCCTCGCATGCGAAAAGGAGTGCAGCTCAGC
CTGCCGCCCCGTCAGCCGTTACTACCGCTTCAGGACAGGCCCAGATGCCCGGTCAGCACGCAGCGATGGGCCAGG
CTACCAACCACGCCTCTCATTCTCTCGACACCGCTGATTACATGGGAAGCCATCATCTTGCTGCTGATCAGGACT
ACCGTCAAAACCCGAGCATGTATCCAGGACAGGTTCCACAGCCACCGTCGGCTCCATACGGCCAAGCCCAGGCTC
CACCAGCTATGTACGGAGACATGGAGGGCATGTATCCCTACTCTGCCATGCAGCCACAGCAGGTGAATATTCTCC
TATGCTCACAAGACTGTGTCATATTCACAAACTCCATTTATAGGCACCCATGTCGTCAGAAGAATTCGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail