Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5020
Gene name
LocationContig_362:1278..2664
Strand+
Gene length (bp)1386
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05022 SRP40_C SRP40, C-terminal domain 5.1E-18 392 459

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P41777|NOLC1_RAT Nucleolar and coiled-body phosphoprotein 1 OS=Rattus norvegicus GN=Nolc1 PE=1 SV=1 384 460 3.0E-07
sp|Q14978|NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 384 460 4.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5020
MTVTRAAAKAARKAATSKMKKATATSKEKARRKKAATSRVKKATATSKEKARRKKAATSRVKKATATSKDKAATS
RAKKATTTSKEKAAPPKGNKAATTKKAAPAEKTKTVSTQYKTASASPSEIEIVDLVAHYLNCEGLTKARSALIKQ
HGKVAAVPDGHGTLNDMYGAWLAARSSVVKQPTLKRKARASSSSDEDSDSSSSCSGGAEPQLKKQKIKVEEEEES
SSDSDSESEDEEKIKVEEEEEEEEEESSSDSDSESEDEEKIKVEEEEEEEESSFDSDSESEYEEMDIAAPGIGIK
PDPADDSFCDSESDSSSDSDLDSDSNTSAHNKDSYSSSSSETDSSSQTDSSSDSDSDCPPLDPSPPIKTEACGPD
SLIPNAQAKRLATPRQRFSRIPQDLQVDARFASNQWVETDYSRRAYQDLSVTKGKGFTKEKNKKKKGSFRGGAID
IGEKRGIYFDD*
Coding >OphauB2|5020
ATGACGGTTACCAGGGCTGCTGCCAAGGCGGCCAGAAAGGCTGCGACTTCAAAGATGAAGAAGGCTACAGCTACG
AGCAAGGAAAAGGCTAGACGGAAAAAGGCTGCGACTTCAAGGGTGAAGAAGGCTACAGCTACGAGCAAGGAAAAG
GCTAGACGGAAAAAGGCTGCGACTTCAAGGGTGAAGAAAGCTACAGCTACGAGCAAGGACAAGGCTGCAACTTCA
AGGGCGAAAAAGGCTACAACTACGAGCAAGGAAAAGGCTGCACCTCCAAAGGGCAACAAGGCTGCAACGACCAAA
AAGGCGGCGCCTGCTGAGAAGACAAAGACTGTCTCCACGCAATACAAGACGGCCTCTGCCTCGCCATCAGAAATA
GAAATTGTCGACCTCGTGGCCCACTATCTCAACTGCGAGGGCCTCACCAAGGCCCGCTCCGCCCTCATCAAGCAG
CACGGCAAAGTAGCAGCCGTGCCCGACGGCCACGGGACGCTTAACGACATGTACGGCGCTTGGCTGGCTGCCAGG
AGCTCCGTGGTTAAGCAGCCGACGCTTAAGCGCAAGGCGCGCGCTAGCTCCAGCTCAGACGAGGACAGCGACAGC
AGCAGTAGCTGCAGTGGTGGTGCTGAGCCGCAGCTCAAGAAACAAAAGATCAAGGTTGAGGAGGAGGAGGAGTCG
TCTTCCGATTCGGATAGTGAGTCTGAAGATGAAGAAAAGATCAAGGTTGAGGAGGAGGAAGAGGAGGAGGAAGAG
GAGTCGTCTTCCGATTCGGATAGTGAGTCTGAAGATGAAGAAAAGATCAAGGTTGAGGAGGAGGAGGAGGAGGAG
GAGTCGTCTTTCGATTCGGATAGTGAGTCTGAATATGAAGAGATGGATATAGCCGCACCAGGCATTGGCATCAAG
CCTGACCCCGCCGACGACTCGTTTTGCGATTCGGAATCAGACTCTAGCTCGGACTCAGACTTGGATTCAGACTCG
AATACTTCTGCACACAACAAGGACTCCTACTCGAGCAGCTCCTCCGAAACCGACAGCTCCTCCCAAACCGACAGC
TCCTCCGACTCTGACAGCGACTGCCCACCCCTTGACCCCTCACCACCCATCAAGACTGAAGCCTGCGGCCCCGAC
TCCCTCATTCCCAACGCTCAAGCCAAGCGTCTCGCGACTCCTAGGCAGCGCTTCTCGCGCATCCCGCAAGACTTA
CAAGTCGATGCGCGCTTTGCGTCGAACCAGTGGGTGGAAACGGATTACTCGCGCAGAGCGTACCAAGACTTGAGC
GTCACAAAGGGAAAGGGCTTCACAAAGGAGAAGAATAAGAAGAAGAAGGGGAGTTTTCGCGGCGGGGCGATTGAT
ATTGGAGAGAAGAGGGGCATTTACTTTGATGATTAG
Transcript >OphauB2|5020
ATGACGGTTACCAGGGCTGCTGCCAAGGCGGCCAGAAAGGCTGCGACTTCAAAGATGAAGAAGGCTACAGCTACG
AGCAAGGAAAAGGCTAGACGGAAAAAGGCTGCGACTTCAAGGGTGAAGAAGGCTACAGCTACGAGCAAGGAAAAG
GCTAGACGGAAAAAGGCTGCGACTTCAAGGGTGAAGAAAGCTACAGCTACGAGCAAGGACAAGGCTGCAACTTCA
AGGGCGAAAAAGGCTACAACTACGAGCAAGGAAAAGGCTGCACCTCCAAAGGGCAACAAGGCTGCAACGACCAAA
AAGGCGGCGCCTGCTGAGAAGACAAAGACTGTCTCCACGCAATACAAGACGGCCTCTGCCTCGCCATCAGAAATA
GAAATTGTCGACCTCGTGGCCCACTATCTCAACTGCGAGGGCCTCACCAAGGCCCGCTCCGCCCTCATCAAGCAG
CACGGCAAAGTAGCAGCCGTGCCCGACGGCCACGGGACGCTTAACGACATGTACGGCGCTTGGCTGGCTGCCAGG
AGCTCCGTGGTTAAGCAGCCGACGCTTAAGCGCAAGGCGCGCGCTAGCTCCAGCTCAGACGAGGACAGCGACAGC
AGCAGTAGCTGCAGTGGTGGTGCTGAGCCGCAGCTCAAGAAACAAAAGATCAAGGTTGAGGAGGAGGAGGAGTCG
TCTTCCGATTCGGATAGTGAGTCTGAAGATGAAGAAAAGATCAAGGTTGAGGAGGAGGAAGAGGAGGAGGAAGAG
GAGTCGTCTTCCGATTCGGATAGTGAGTCTGAAGATGAAGAAAAGATCAAGGTTGAGGAGGAGGAGGAGGAGGAG
GAGTCGTCTTTCGATTCGGATAGTGAGTCTGAATATGAAGAGATGGATATAGCCGCACCAGGCATTGGCATCAAG
CCTGACCCCGCCGACGACTCGTTTTGCGATTCGGAATCAGACTCTAGCTCGGACTCAGACTTGGATTCAGACTCG
AATACTTCTGCACACAACAAGGACTCCTACTCGAGCAGCTCCTCCGAAACCGACAGCTCCTCCCAAACCGACAGC
TCCTCCGACTCTGACAGCGACTGCCCACCCCTTGACCCCTCACCACCCATCAAGACTGAAGCCTGCGGCCCCGAC
TCCCTCATTCCCAACGCTCAAGCCAAGCGTCTCGCGACTCCTAGGCAGCGCTTCTCGCGCATCCCGCAAGACTTA
CAAGTCGATGCGCGCTTTGCGTCGAACCAGTGGGTGGAAACGGATTACTCGCGCAGAGCGTACCAAGACTTGAGC
GTCACAAAGGGAAAGGGCTTCACAAAGGAGAAGAATAAGAAGAAGAAGGGGAGTTTTCGCGGCGGGGCGATTGAT
ATTGGAGAGAAGAGGGGCATTTACTTTGATGATTAG
Gene >OphauB2|5020
ATGACGGTTACCAGGGCTGCTGCCAAGGCGGCCAGAAAGGCTGCGACTTCAAAGATGAAGAAGGCTACAGCTACG
AGCAAGGAAAAGGCTAGACGGAAAAAGGCTGCGACTTCAAGGGTGAAGAAGGCTACAGCTACGAGCAAGGAAAAG
GCTAGACGGAAAAAGGCTGCGACTTCAAGGGTGAAGAAAGCTACAGCTACGAGCAAGGACAAGGCTGCAACTTCA
AGGGCGAAAAAGGCTACAACTACGAGCAAGGAAAAGGCTGCACCTCCAAAGGGCAACAAGGCTGCAACGACCAAA
AAGGCGGCGCCTGCTGAGAAGACAAAGACTGTCTCCACGCAATACAAGACGGCCTCTGCCTCGCCATCAGAAATA
GAAATTGTCGACCTCGTGGCCCACTATCTCAACTGCGAGGGCCTCACCAAGGCCCGCTCCGCCCTCATCAAGCAG
CACGGCAAAGTAGCAGCCGTGCCCGACGGCCACGGGACGCTTAACGACATGTACGGCGCTTGGCTGGCTGCCAGG
AGCTCCGTGGTTAAGCAGCCGACGCTTAAGCGCAAGGCGCGCGCTAGCTCCAGCTCAGACGAGGACAGCGACAGC
AGCAGTAGCTGCAGTGGTGGTGCTGAGCCGCAGCTCAAGAAACAAAAGATCAAGGTTGAGGAGGAGGAGGAGTCG
TCTTCCGATTCGGATAGTGAGTCTGAAGATGAAGAAAAGATCAAGGTTGAGGAGGAGGAAGAGGAGGAGGAAGAG
GAGTCGTCTTCCGATTCGGATAGTGAGTCTGAAGATGAAGAAAAGATCAAGGTTGAGGAGGAGGAGGAGGAGGAG
GAGTCGTCTTTCGATTCGGATAGTGAGTCTGAATATGAAGAGATGGATATAGCCGCACCAGGCATTGGCATCAAG
CCTGACCCCGCCGACGACTCGTTTTGCGATTCGGAATCAGACTCTAGCTCGGACTCAGACTTGGATTCAGACTCG
AATACTTCTGCACACAACAAGGACTCCTACTCGAGCAGCTCCTCCGAAACCGACAGCTCCTCCCAAACCGACAGC
TCCTCCGACTCTGACAGCGACTGCCCACCCCTTGACCCCTCACCACCCATCAAGACTGAAGCCTGCGGCCCCGAC
TCCCTCATTCCCAACGCTCAAGCCAAGCGTCTCGCGACTCCTAGGCAGCGCTTCTCGCGCATCCCGCAAGACTTA
CAAGTCGATGCGCGCTTTGCGTCGAACCAGTGGGTGGAAACGGATTACTCGCGCAGAGCGTACCAAGACTTGAGC
GTCACAAAGGGAAAGGGCTTCACAAAGGAGAAGAATAAGAAGAAGAAGGGGAGTTTTCGCGGCGGGGCGATTGAT
ATTGGAGAGAAGAGGGGCATTTACTTTGATGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail