Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|502
Gene name
LocationContig_108:64648..66952
Strand+
Gene length (bp)2304
Transcript length (bp)2199
Coding sequence length (bp)2199
Protein length (aa) 733

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04734 Ceramidase_alk Neutral/alkaline non-lysosomal ceramidase, N-terminal 6.1E-221 43 564
PF17048 Ceramidse_alk_C Neutral/alkaline non-lysosomal ceramidase, C-terminal 1.5E-55 581 730

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 43 715 1.0E-159
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 20 731 2.0E-152
sp|Q29C43|NCASE_DROPS Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1 19 732 7.0E-151
sp|Q55G11|NCSEB_DICDI Neutral ceramidase B OS=Dictyostelium discoideum GN=dcd2B PE=3 SV=1 43 729 7.0E-144
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 43 732 1.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 43 715 1.0E-159
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 20 731 2.0E-152
sp|Q29C43|NCASE_DROPS Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1 19 732 7.0E-151
sp|Q55G11|NCSEB_DICDI Neutral ceramidase B OS=Dictyostelium discoideum GN=dcd2B PE=3 SV=1 43 729 7.0E-144
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 43 732 1.0E-138
sp|Q9NR71|ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2 43 731 7.0E-138
sp|Q9JHE3|ASAH2_MOUSE Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1 43 731 5.0E-135
sp|Q54BK2|NCSEA_DICDI Neutral ceramidase A OS=Dictyostelium discoideum GN=dcd2A PE=1 SV=1 19 731 6.0E-134
sp|Q91XT9|ASAH2_RAT Neutral ceramidase OS=Rattus norvegicus GN=Asah2 PE=1 SV=1 43 731 7.0E-129
sp|Q9I596|NCASE_PSEAE Neutral ceramidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0845 PE=1 SV=1 43 731 2.0E-107
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 285 731 2.0E-95
sp|O06769|NCASE_MYCTU Neutral ceramidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0669c PE=1 SV=1 45 731 6.0E-87
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 34 273 8.0E-47
sp|P0C7U1|ASA2B_HUMAN Putative inactive neutral ceramidase B OS=Homo sapiens GN=ASAH2B PE=2 SV=1 604 731 7.0E-13
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 36 0.99936

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup74
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|149
Ophiocordyceps australis 1348a (Ghana) OphauG2|4414
Ophiocordyceps australis 1348a (Ghana) OphauG2|5649
Ophiocordyceps australis map64 (Brazil) OphauB2|502 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5266
Ophiocordyceps australis map64 (Brazil) OphauB2|7887
Ophiocordyceps camponoti-floridani Ophcf2|01033
Ophiocordyceps camponoti-floridani Ophcf2|01218
Ophiocordyceps camponoti-floridani Ophcf2|02102
Ophiocordyceps camponoti-rufipedis Ophun1|1793
Ophiocordyceps camponoti-rufipedis Ophun1|6086
Ophiocordyceps kimflemingae Ophio5|1151
Ophiocordyceps kimflemingae Ophio5|2727
Ophiocordyceps kimflemingae Ophio5|723
Ophiocordyceps subramaniannii Hirsu2|3661
Ophiocordyceps subramaniannii Hirsu2|7981

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|502
MAMATATVGGHGAFSTRGLSLMLLAAVLLSSAMCAAAELGDKYLIGVGKADITGPVVEIGFAGYANLDQVGTGLR
QRLRSRAFIVADANNSLDRFVYLILDAQSGDTAVRYGVIEALHALGPEYAVYGHNNIALTGTHSHAGPGAWFNYL
LPQITTKGFDKQSLQALVDGAVLSIKRAHEKLQEGHLDVGTTVIKDGAINRSLYAYLANPQAERDRYKAETDTTM
TLLRFRRASDGKTMGVLSWFPVHGTSMLGNNTHAAADNKGVAAWLLEEALAGKETVADGFVAGFSQANVGDTTPN
VLGAYCDDGSGQPCSLENSTCADGRSQRCHGRGPEFRALDLGVRSCYEMGRRQFAGAKHIYDSLHESGTPVVGPT
VKAFHFFHDMSFWQFARPSGELVQTCPAALGYSFAAGTSDWPGAFDFTQGDSGEPHANPVWKLVSGLLRTPTRAQ
KQCQGSKPILLDVGEISQPYAWTPNIVDIQALRVGQLVIIVSPSEATTMSGRRWREAVAREASSFLGKQQPIVVL
GGPANTYAHYVATAEEYQVQRYEGASTLFGPHQLDAYINLTLSGMHHLRPDAPRGQVPDQGPLPPDNRGKALSFI
TGVVMDSHPLRSDFGHVLLQPQAMARLGQVVKATFQGANPRNNLRLEDTFAAVEQQDAAGQWHRVRDDSDWFLVY
SWRRTNFLLGYSEVDVTWETDGNASPGTYRIKYYGDAKPLLGSIVPFEGVTRSFSLS*
Coding >OphauB2|502
ATGGCCATGGCTACAGCAACTGTTGGTGGTCATGGAGCCTTTTCCACGAGGGGCTTGTCTCTGATGCTGCTGGCC
GCTGTGCTCTTGAGCTCAGCCATGTGCGCCGCCGCCGAGCTCGGCGACAAGTATCTGATTGGCGTCGGCAAAGCA
GACATTACGGGGCCTGTTGTTGAGATTGGCTTTGCTGGGTATGCAAATCTCGACCAGGTCGGGACTGGGCTTCGC
CAGCGGCTGCGCAGCCGTGCCTTTATCGTTGCCGACGCCAATAATTCTCTAGATCGCTTCGTCTACCTCATTCTG
GATGCTCAAAGCGGCGACACGGCCGTGCGCTATGGCGTCATTGAGGCCCTGCATGCCCTGGGCCCCGAGTACGCA
GTATACGGCCACAACAACATTGCCTTGACGGGCACGCATAGCCATGCTGGCCCAGGCGCCTGGTTCAACTACCTG
TTGCCACAGATAACCACCAAGGGCTTTGACAAGCAAAGTCTGCAGGCGCTGGTTGATGGAGCCGTCTTGTCCATC
AAGCGTGCCCATGAGAAGCTCCAAGAGGGCCATCTCGATGTGGGCACCACAGTCATCAAGGACGGCGCCATCAAC
CGCTCCTTGTATGCCTATCTCGCCAACCCGCAGGCAGAGCGCGACCGGTACAAGGCGGAGACGGACACGACAATG
ACGCTGCTTCGCTTCCGCCGCGCTTCGGACGGCAAGACCATGGGCGTGCTGTCTTGGTTCCCTGTCCACGGCACA
TCGATGCTGGGCAACAATACGCATGCGGCCGCCGATAACAAGGGAGTGGCGGCCTGGCTGCTGGAGGAGGCGCTT
GCCGGCAAGGAGACGGTGGCCGACGGCTTCGTTGCCGGCTTCAGCCAGGCCAATGTCGGCGACACGACGCCCAAT
GTGCTTGGTGCCTACTGTGACGACGGCTCTGGCCAGCCGTGTAGCTTGGAGAACAGCACCTGTGCCGACGGCCGG
TCGCAGAGGTGCCATGGCCGCGGCCCCGAATTCCGCGCGCTGGACCTTGGCGTACGGAGCTGCTACGAGATGGGG
CGGCGACAGTTTGCTGGGGCCAAGCACATTTACGACTCTCTGCATGAGTCGGGCACGCCCGTGGTGGGCCCGACG
GTCAAGGCATTTCACTTTTTCCACGACATGAGCTTCTGGCAATTTGCGCGCCCCAGCGGCGAGCTCGTCCAGACG
TGTCCTGCCGCTCTCGGCTACTCCTTTGCAGCCGGCACCTCTGACTGGCCTGGCGCATTCGACTTCACCCAGGGC
GACTCTGGCGAGCCCCATGCCAATCCAGTGTGGAAGCTGGTGTCTGGCTTGTTGCGGACGCCCACGCGTGCGCAA
AAGCAGTGCCAGGGCTCCAAGCCCATATTGCTCGACGTTGGCGAGATCAGCCAGCCCTATGCCTGGACGCCCAAC
ATTGTCGACATACAAGCCCTGCGCGTGGGCCAACTAGTCATTATTGTGAGCCCAAGTGAGGCAACAACAATGAGC
GGCCGCCGCTGGCGCGAGGCGGTGGCCCGCGAGGCATCGTCCTTTCTCGGCAAGCAGCAGCCCATTGTTGTTTTG
GGCGGCCCGGCCAACACGTATGCCCACTATGTGGCCACAGCCGAGGAGTACCAGGTGCAGCGCTACGAGGGAGCG
TCGACGCTGTTTGGGCCGCACCAGCTTGACGCCTACATCAACCTGACGCTCAGCGGCATGCATCATCTTCGCCCG
GATGCCCCCCGCGGACAAGTGCCAGACCAAGGCCCGCTGCCGCCCGACAACCGCGGCAAGGCGCTCTCTTTTATC
ACGGGCGTCGTCATGGACAGCCATCCCTTGCGTTCCGACTTTGGCCACGTGCTGCTGCAGCCGCAAGCCATGGCT
CGCCTGGGCCAAGTCGTCAAGGCCACCTTTCAGGGCGCCAATCCCCGCAACAACTTGCGGCTCGAAGACACCTTT
GCAGCTGTAGAGCAGCAGGATGCCGCCGGCCAGTGGCACCGCGTGCGCGACGACAGCGACTGGTTTCTCGTCTAC
TCGTGGCGCCGCACCAACTTCCTGCTCGGCTATAGCGAGGTGGACGTGACATGGGAGACGGACGGCAACGCGTCG
CCAGGAACTTATCGCATCAAGTACTACGGTGATGCCAAGCCCTTGCTTGGCAGCATTGTGCCCTTTGAAGGCGTC
ACTCGAAGCTTTAGCCTGAGCTAG
Transcript >OphauB2|502
ATGGCCATGGCTACAGCAACTGTTGGTGGTCATGGAGCCTTTTCCACGAGGGGCTTGTCTCTGATGCTGCTGGCC
GCTGTGCTCTTGAGCTCAGCCATGTGCGCCGCCGCCGAGCTCGGCGACAAGTATCTGATTGGCGTCGGCAAAGCA
GACATTACGGGGCCTGTTGTTGAGATTGGCTTTGCTGGGTATGCAAATCTCGACCAGGTCGGGACTGGGCTTCGC
CAGCGGCTGCGCAGCCGTGCCTTTATCGTTGCCGACGCCAATAATTCTCTAGATCGCTTCGTCTACCTCATTCTG
GATGCTCAAAGCGGCGACACGGCCGTGCGCTATGGCGTCATTGAGGCCCTGCATGCCCTGGGCCCCGAGTACGCA
GTATACGGCCACAACAACATTGCCTTGACGGGCACGCATAGCCATGCTGGCCCAGGCGCCTGGTTCAACTACCTG
TTGCCACAGATAACCACCAAGGGCTTTGACAAGCAAAGTCTGCAGGCGCTGGTTGATGGAGCCGTCTTGTCCATC
AAGCGTGCCCATGAGAAGCTCCAAGAGGGCCATCTCGATGTGGGCACCACAGTCATCAAGGACGGCGCCATCAAC
CGCTCCTTGTATGCCTATCTCGCCAACCCGCAGGCAGAGCGCGACCGGTACAAGGCGGAGACGGACACGACAATG
ACGCTGCTTCGCTTCCGCCGCGCTTCGGACGGCAAGACCATGGGCGTGCTGTCTTGGTTCCCTGTCCACGGCACA
TCGATGCTGGGCAACAATACGCATGCGGCCGCCGATAACAAGGGAGTGGCGGCCTGGCTGCTGGAGGAGGCGCTT
GCCGGCAAGGAGACGGTGGCCGACGGCTTCGTTGCCGGCTTCAGCCAGGCCAATGTCGGCGACACGACGCCCAAT
GTGCTTGGTGCCTACTGTGACGACGGCTCTGGCCAGCCGTGTAGCTTGGAGAACAGCACCTGTGCCGACGGCCGG
TCGCAGAGGTGCCATGGCCGCGGCCCCGAATTCCGCGCGCTGGACCTTGGCGTACGGAGCTGCTACGAGATGGGG
CGGCGACAGTTTGCTGGGGCCAAGCACATTTACGACTCTCTGCATGAGTCGGGCACGCCCGTGGTGGGCCCGACG
GTCAAGGCATTTCACTTTTTCCACGACATGAGCTTCTGGCAATTTGCGCGCCCCAGCGGCGAGCTCGTCCAGACG
TGTCCTGCCGCTCTCGGCTACTCCTTTGCAGCCGGCACCTCTGACTGGCCTGGCGCATTCGACTTCACCCAGGGC
GACTCTGGCGAGCCCCATGCCAATCCAGTGTGGAAGCTGGTGTCTGGCTTGTTGCGGACGCCCACGCGTGCGCAA
AAGCAGTGCCAGGGCTCCAAGCCCATATTGCTCGACGTTGGCGAGATCAGCCAGCCCTATGCCTGGACGCCCAAC
ATTGTCGACATACAAGCCCTGCGCGTGGGCCAACTAGTCATTATTGTGAGCCCAAGTGAGGCAACAACAATGAGC
GGCCGCCGCTGGCGCGAGGCGGTGGCCCGCGAGGCATCGTCCTTTCTCGGCAAGCAGCAGCCCATTGTTGTTTTG
GGCGGCCCGGCCAACACGTATGCCCACTATGTGGCCACAGCCGAGGAGTACCAGGTGCAGCGCTACGAGGGAGCG
TCGACGCTGTTTGGGCCGCACCAGCTTGACGCCTACATCAACCTGACGCTCAGCGGCATGCATCATCTTCGCCCG
GATGCCCCCCGCGGACAAGTGCCAGACCAAGGCCCGCTGCCGCCCGACAACCGCGGCAAGGCGCTCTCTTTTATC
ACGGGCGTCGTCATGGACAGCCATCCCTTGCGTTCCGACTTTGGCCACGTGCTGCTGCAGCCGCAAGCCATGGCT
CGCCTGGGCCAAGTCGTCAAGGCCACCTTTCAGGGCGCCAATCCCCGCAACAACTTGCGGCTCGAAGACACCTTT
GCAGCTGTAGAGCAGCAGGATGCCGCCGGCCAGTGGCACCGCGTGCGCGACGACAGCGACTGGTTTCTCGTCTAC
TCGTGGCGCCGCACCAACTTCCTGCTCGGCTATAGCGAGGTGGACGTGACATGGGAGACGGACGGCAACGCGTCG
CCAGGAACTTATCGCATCAAGTACTACGGTGATGCCAAGCCCTTGCTTGGCAGCATTGTGCCCTTTGAAGGCGTC
ACTCGAAGCTTTAGCCTGAGCTAG
Gene >OphauB2|502
ATGGCCATGGCTACAGCAACTGTTGGTGGTCATGGAGCCTTTTCCACGAGGGGCTTGTCTCTGATGCTGCTGGCC
GCTGTGCTCTTGAGCTCAGCCATGTGCGCCGCCGCCGAGCTCGGCGACAAGTATCTGATTGGCGTCGGCAAAGCA
GACATTACGGGGCCTGTTGTTGAGATTGGCTTTGCTGGGTATGCAAATCTCGACCAGGTCGGGACTGGGCTTCGC
CAGCGGCTGCGCAGCCGTGCCTTTATCGTTGCCGACGCCAATAATTCTCTAGATCGCTTCGTCTACCTCATTCTG
GATGCTCAAAGCGGCGACACGGCCGTGCGCTATGGCGTCATTGAGGCCCTGCATGCCCTGGGCCCCGAGTACGCA
GTATACGGCCACAACAACATTGCCTTGACGGGCACGCATAGCCATGCTGGCCCAGGCGCCTGGTTCAACTACCTG
TTGCCACAGATAACCACCAAGGGCTTTGACAAGCAAAGTCTGCAGGCGCTGGTTGATGGAGCCGTCTTGTCCATC
AAGCGTGCCCATGAGAAGCTCCAAGAGGTAAGTCGGTGCAGCTGCGAGGCCAGCACCAGTCCTACTCATGCCATG
TCGTTAGGGCCATCTCGATGTGGGCACCACAGTCATCAAGGACGGCGCCATCAACCGCTCCTTGTATGCCTATCT
CGCCAACCCGCAGGCAGAGCGCGACCGGTACAAGGCGGAGACGGACACGACAATGACGCTGCTTCGCTTCCGCCG
CGCTTCGGACGGCAAGACCATGGGCGTGCTGTCTTGGTTCCCTGTCCACGGCACATCGATGCTGGGCAACAATAC
GCATGCGGCCGCCGATAACAAGGGAGTGGCGGCCTGGCTGCTGGAGGAGGCGCTTGCCGGCAAGGAGACGGTGGC
CGACGGCTTCGTTGCCGGCTTCAGCCAGGCCAATGTCGGCGACACGACGCCCAATGTGCTTGGTGCCTACTGTGA
CGACGGCTCTGGCCAGCCGTGTAGCTTGGAGAACAGCACCTGTGCCGACGGCCGGTCGCAGAGGTGCCATGGCCG
CGGCCCCGAATTCCGCGCGCTGGACCTTGGCGTACGGAGCTGCTACGAGATGGGGCGGCGACAGTTTGCTGGGGC
CAAGCACATTTACGTATGCCTCGTGCCAAGCCGTACCTGTTGTCTGCTGACGGCTTGAGACAGGACTCTCTGCAT
GAGTCGGGCACGCCCGTGGTGGGCCCGACGGTCAAGGCATTTCACTTTTTCCACGACATGAGCTTCTGGCAATTT
GCGCGCCCCAGCGGCGAGCTCGTCCAGACGTGTCCTGCCGCTCTCGGCTACTCCTTTGCAGCCGGCACCTCTGAC
TGGCCTGGCGCATTCGACTTCACCCAGGGCGACTCTGGCGAGCCCCATGCCAATCCAGTGTGGAAGCTGGTGTCT
GGCTTGTTGCGGACGCCCACGCGTGCGCAAAAGCAGTGCCAGGGCTCCAAGCCCATATTGCTCGACGTTGGCGAG
ATCAGCCAGCCCTATGCCTGGACGCCCAACATTGTCGACATACAAGCCCTGCGCGTGGGCCAACTAGTCATTATT
GTGAGCCCAAGTGAGGCAACAACAATGAGCGGCCGCCGCTGGCGCGAGGCGGTGGCCCGCGAGGCATCGTCCTTT
CTCGGCAAGCAGCAGCCCATTGTTGTTTTGGGCGGCCCGGCCAACACGTATGCCCACTATGTGGCCACAGCCGAG
GAGTACCAGGTGCAGCGCTACGAGGGAGCGTCGACGCTGTTTGGGCCGCACCAGCTTGACGCCTACATCAACCTG
ACGCTCAGCGGCATGCATCATCTTCGCCCGGATGCCCCCCGCGGACAAGTGCCAGACCAAGGCCCGCTGCCGCCC
GACAACCGCGGCAAGGCGCTCTCTTTTATCACGGGCGTCGTCATGGACAGCCATCCCTTGCGTTCCGACTTTGGC
CACGTGCTGCTGCAGCCGCAAGCCATGGCTCGCCTGGGCCAAGTCGTCAAGGCCACCTTTCAGGGCGCCAATCCC
CGCAACAACTTGCGGCTCGAAGACACCTTTGCAGCTGTAGAGCAGCAGGATGCCGCCGGCCAGTGGCACCGCGTG
CGCGACGACAGCGACTGGTTTCTCGTCTACTCGTGGCGCCGCACCAACTTCCTGCTCGGCTATAGCGAGGTGGAC
GTGACATGGGAGACGGACGGCAACGCGTCGCCAGGAACTTATCGCATCAAGTACTACGGTGATGCCAAGCCCTTG
CTTGGCAGCATTGTGCCCTTTGAAGGCGTCACTCGAAGCTTTAGCCTGAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail