Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5017
Gene name
LocationContig_361:225..1250
Strand-
Gene length (bp)1025
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family 3.7E-27 75 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ING7|FLAD1_XENLA FAD synthase OS=Xenopus laevis GN=flad1 PE=2 SV=1 55 284 3.0E-51
sp|O74841|FAD1_SCHPO Probable FAD synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1235.04c PE=3 SV=1 55 286 8.0E-51
sp|Q8R123|FAD1_MOUSE FAD synthase OS=Mus musculus GN=Flad1 PE=1 SV=1 55 284 2.0E-49
sp|Q68EH8|FAD1_DANRE FAD synthase OS=Danio rerio GN=flad1 PE=2 SV=1 55 274 4.0E-48
sp|Q5RCH4|FAD1_PONAB FAD synthase OS=Pongo abelii GN=FLAD1 PE=2 SV=1 55 284 6.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ING7|FLAD1_XENLA FAD synthase OS=Xenopus laevis GN=flad1 PE=2 SV=1 55 284 3.0E-51
sp|O74841|FAD1_SCHPO Probable FAD synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1235.04c PE=3 SV=1 55 286 8.0E-51
sp|Q8R123|FAD1_MOUSE FAD synthase OS=Mus musculus GN=Flad1 PE=1 SV=1 55 284 2.0E-49
sp|Q68EH8|FAD1_DANRE FAD synthase OS=Danio rerio GN=flad1 PE=2 SV=1 55 274 4.0E-48
sp|Q5RCH4|FAD1_PONAB FAD synthase OS=Pongo abelii GN=FLAD1 PE=2 SV=1 55 284 6.0E-46
sp|Q8NFF5|FAD1_HUMAN FAD synthase OS=Homo sapiens GN=FLAD1 PE=1 SV=1 55 284 8.0E-46
sp|Q22017|FAD1_CAEEL Probable FAD synthase OS=Caenorhabditis elegans GN=flad-1 PE=3 SV=1 55 284 2.0E-41
sp|Q626I0|FLAD1_CAEBR Probable FAD synthase OS=Caenorhabditis briggsae GN=CBG00973 PE=3 SV=1 55 284 6.0E-39
sp|P38913|FAD1_YEAST FAD synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAD1 PE=1 SV=1 74 274 4.0E-28
sp|B0U6V9|CYSH_XYLFM Phosphoadenosine phosphosulfate reductase OS=Xylella fastidiosa (strain M12) GN=cysH PE=3 SV=1 166 255 8.0E-09
sp|Q9PD82|CYSH_XYLFA Phosphoadenosine phosphosulfate reductase OS=Xylella fastidiosa (strain 9a5c) GN=cysH PE=3 SV=1 166 255 1.0E-08
sp|Q87DH1|CYSH_XYLFT Phosphoadenosine phosphosulfate reductase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysH PE=3 SV=1 166 255 2.0E-08
sp|B2IA30|CYSH_XYLF2 Phosphoadenosine phosphosulfate reductase OS=Xylella fastidiosa (strain M23) GN=cysH PE=3 SV=1 166 255 2.0E-08
sp|Q9JRT1|CYSH_NEIMB Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysH1 PE=3 SV=1 178 279 3.0E-07
sp|Q9JUD5|CYSH_NEIMA Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysH PE=3 SV=1 178 285 3.0E-07
sp|Q3BPY3|CYSH_XANC5 Phosphoadenosine phosphosulfate reductase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cysH PE=3 SV=1 157 254 2.0E-06
sp|Q0A6T1|CYSH_ALKEH Phosphoadenosine phosphosulfate reductase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cysH PE=3 SV=1 166 254 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5017
MTKSSPSLVNGSAEEAASAALLKTCTSLRRQVQAFVDQGPEPEKQDAPLCTTRLRVAESLTIIQEALRRYRHQEL
SLSYNGGKDCLVLLILILSCLPAAMDHDDKPQCNGVNKPTATPHTTGQQESLLRPLQAIYIAPPDPFPEVEDFVA
LSTAHYQLSLTRYALPMRQALEAYRHDMPAVNAIFMGTRRTDPHSEFLTPFSPTDKDWPQFMRINPVLDWQYHEI
WAFIRHLDIPFCSLYNQGYTSLGGVKNTRPNPALALNGDVTAYRPAYELQCENEERLGRHG*
Coding >OphauB2|5017
ATGACCAAGTCCTCGCCGTCACTGGTCAATGGCTCCGCAGAGGAAGCGGCTTCTGCTGCTCTGCTAAAGACATGC
ACGTCTCTGCGTCGCCAAGTACAGGCCTTTGTCGATCAAGGGCCCGAGCCAGAGAAGCAAGACGCTCCACTATGC
ACCACTCGTTTACGCGTGGCCGAGTCTTTGACAATTATACAAGAGGCGCTTCGGCGATACCGGCATCAAGAGCTG
TCGCTCTCGTACAATGGCGGCAAGGACTGTCTGGTCCTGCTCATCCTCATTCTATCATGTCTGCCAGCTGCCATG
GATCATGATGATAAGCCACAGTGCAACGGCGTAAACAAGCCGACGGCTACCCCGCACACTACAGGGCAGCAAGAG
TCGTTGTTACGGCCGCTGCAAGCTATATACATTGCGCCACCCGACCCATTTCCCGAGGTGGAGGACTTTGTCGCC
CTCTCGACGGCACACTATCAACTAAGCCTCACGCGATACGCACTGCCCATGCGTCAAGCCCTCGAGGCCTACCGA
CATGACATGCCCGCTGTCAATGCCATTTTCATGGGCACAAGACGCACCGACCCCCACAGCGAGTTTCTGACTCCC
TTCAGTCCGACCGACAAGGACTGGCCGCAGTTTATGCGCATCAATCCTGTCCTAGACTGGCAATACCATGAGATT
TGGGCTTTCATCAGACACCTCGACATTCCCTTTTGCAGCTTGTACAACCAAGGATACACGTCACTGGGAGGTGTC
AAGAACACGCGACCGAATCCCGCGCTGGCGCTCAACGGTGACGTGACAGCTTACCGGCCAGCCTATGAGCTGCAA
TGCGAAAACGAGGAGCGCCTGGGACGCCACGGATAG
Transcript >OphauB2|5017
ATGACCAAGTCCTCGCCGTCACTGGTCAATGGCTCCGCAGAGGAAGCGGCTTCTGCTGCTCTGCTAAAGACATGC
ACGTCTCTGCGTCGCCAAGTACAGGCCTTTGTCGATCAAGGGCCCGAGCCAGAGAAGCAAGACGCTCCACTATGC
ACCACTCGTTTACGCGTGGCCGAGTCTTTGACAATTATACAAGAGGCGCTTCGGCGATACCGGCATCAAGAGCTG
TCGCTCTCGTACAATGGCGGCAAGGACTGTCTGGTCCTGCTCATCCTCATTCTATCATGTCTGCCAGCTGCCATG
GATCATGATGATAAGCCACAGTGCAACGGCGTAAACAAGCCGACGGCTACCCCGCACACTACAGGGCAGCAAGAG
TCGTTGTTACGGCCGCTGCAAGCTATATACATTGCGCCACCCGACCCATTTCCCGAGGTGGAGGACTTTGTCGCC
CTCTCGACGGCACACTATCAACTAAGCCTCACGCGATACGCACTGCCCATGCGTCAAGCCCTCGAGGCCTACCGA
CATGACATGCCCGCTGTCAATGCCATTTTCATGGGCACAAGACGCACCGACCCCCACAGCGAGTTTCTGACTCCC
TTCAGTCCGACCGACAAGGACTGGCCGCAGTTTATGCGCATCAATCCTGTCCTAGACTGGCAATACCATGAGATT
TGGGCTTTCATCAGACACCTCGACATTCCCTTTTGCAGCTTGTACAACCAAGGATACACGTCACTGGGAGGTGTC
AAGAACACGCGACCGAATCCCGCGCTGGCGCTCAACGGTGACGTGACAGCTTACCGGCCAGCCTATGAGCTGCAA
TGCGAAAACGAGGAGCGCCTGGGACGCCACGGATAG
Gene >OphauB2|5017
ATGACCAAGTCCTCGCCGTCACTGGTCAATGGCTCCGCAGAGGAAGCGGCTTCTGCTGCTCTGCTAAAGACATGC
ACGTCTCTGCGTCGCCAAGTACAGGCCTTTGTCGATCAAGGGCCCGAGCCAGAGAAGCAAGACGCTCCACTATGC
ACCACTCGTTTACGCGTGGCCGAGTCTTTGACAATTATACAAGAGGCGCTTCGGCGATACCGGTGCGTTGGGCTT
ATCCTGCCTCACCTCTGCCGAATTGCACGCCACACCCAGCCGCCACGACTCCAGTCAAGCTAACGGATGGCCCAC
GGACTAGGCATCAAGAGCTGTCGCTCTCGTACAATGGCGGCAAGGACTGTCTGGTCCTGCTCATCCTCATTCTAT
CATGTCTGCCAGCTGCCATGGATCATGATGATAAGCCACAGTGCAACGGCGTAAACAAGCCGACGGCTACCCCGC
ACACTACAGGGCAGCAAGAGTCGTTGTTACGGCCGCTGCAAGCTATATACATTGCGCCACCCGACCCATTTCCCG
AGGTGGAGGACTTTGTCGCCCTCTCGACGGCACACTATCAACTAAGCCTCACGCGATACGCACTGCCCATGCGTC
AAGCCCTCGAGGCCTACCGACATGACATGCCCGCTGTCAATGCCATTTTCATGGGCACAAGACGCACCGACCCCC
ACAGCGAGTTTCTGACTCCCTTCAGTCCGACCGACAAGGACTGGCCGCAGTTTATGCGCATCAATCCTGTCCTAG
ACTGGCAATACCATGAGATTTGGGCTGTAAGCACCGCCACAATGGCCTTTGGCAAGTACCTCGTGTCATAATGGC
TTGTGCTGACTCAATTGCAGTTCATCAGACACCTCGACATTCCCTTTTGCAGCTTGTACAACCAAGGATACACGT
CACTGGGAGGTGTCAAGAACACGCGACCGAATCCCGCGCTGGCGCTCAACGGTGACGTGACAGCTTACCGGCCAG
CCTATGAGCTGCAATGCGAAAACGAGGAGCGCCTGGGACGCCACGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail