Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5013
Gene name
LocationContig_36:126168..127178
Strand-
Gene length (bp)1010
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04106 APG5 Autophagy protein Apg5 1.2E-45 70 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HGZ8|ATG5_CHAGB Autophagy protein 5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG5 PE=3 SV=1 5 263 3.0E-103
sp|Q872C6|ATG5_NEUCR Autophagy-related protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-4 PE=3 SV=3 7 263 3.0E-97
sp|A7EJG6|ATG5_SCLS1 Autophagy protein 5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg5 PE=3 SV=1 9 263 7.0E-87
sp|Q525E4|ATG5_MAGO7 Autophagy protein 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG5 PE=2 SV=1 2 262 7.0E-87
sp|A1CE93|ATG5_ASPCL Autophagy protein 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg5 PE=3 SV=2 3 261 7.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HGZ8|ATG5_CHAGB Autophagy protein 5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG5 PE=3 SV=1 5 263 3.0E-103
sp|Q872C6|ATG5_NEUCR Autophagy-related protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-4 PE=3 SV=3 7 263 3.0E-97
sp|A7EJG6|ATG5_SCLS1 Autophagy protein 5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg5 PE=3 SV=1 9 263 7.0E-87
sp|Q525E4|ATG5_MAGO7 Autophagy protein 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG5 PE=2 SV=1 2 262 7.0E-87
sp|A1CE93|ATG5_ASPCL Autophagy protein 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg5 PE=3 SV=2 3 261 7.0E-51
sp|A1DMA1|ATG5_NEOFI Autophagy protein 5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg5 PE=3 SV=1 4 261 9.0E-47
sp|A7KAL6|ATG5_PENRW Autophagy protein 5 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg5 PE=3 SV=1 4 261 9.0E-47
sp|Q4WNA5|ATG5_ASPFU Autophagy protein 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg5 PE=3 SV=1 4 261 5.0E-46
sp|Q2UBM1|ATG5_ASPOR Autophagy protein 5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg5 PE=3 SV=1 3 261 6.0E-46
sp|Q0CRF3|ATG5_ASPTN Autophagy protein 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg5 PE=3 SV=2 3 261 6.0E-45
sp|Q5B2Q6|ATG5_EMENI Autophagy protein 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg5 PE=3 SV=2 3 261 1.0E-43
sp|A6RE26|ATG5_AJECN Autophagy protein 5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG5 PE=3 SV=1 4 261 9.0E-42
sp|Q0UXN8|ATG5_PHANO Autophagy protein 5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG5 PE=3 SV=1 1 263 3.0E-41
sp|Q1DP17|ATG5_COCIM Autophagy protein 5 OS=Coccidioides immitis (strain RS) GN=ATG5 PE=3 SV=1 5 261 3.0E-34
sp|Q6C4Q6|ATG5_YARLI Autophagy protein 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG5 PE=3 SV=2 97 263 1.0E-23
sp|O74971|ATG5_SCHPO Autophagy protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg5 PE=1 SV=1 4 262 6.0E-23
sp|A7KAI4|ATG5_PICAN Autophagy protein 5 OS=Pichia angusta GN=ATG5 PE=3 SV=1 22 268 2.0E-17
sp|Q3MQ06|ATG5_RAT Autophagy protein 5 OS=Rattus norvegicus GN=Atg5 PE=2 SV=1 1 262 3.0E-16
sp|Q99J83|ATG5_MOUSE Autophagy protein 5 OS=Mus musculus GN=Atg5 PE=1 SV=1 1 262 7.0E-16
sp|Q3MQ04|ATG5_PIG Autophagy protein 5 OS=Sus scrofa GN=ATG5 PE=2 SV=1 1 262 2.0E-15
sp|Q9H1Y0|ATG5_HUMAN Autophagy protein 5 OS=Homo sapiens GN=ATG5 PE=1 SV=2 1 262 4.0E-15
sp|Q3MQ24|ATG5_BOVIN Autophagy protein 5 OS=Bos taurus GN=ATG5 PE=2 SV=2 1 262 6.0E-15
sp|Q5R792|ATG5_PONAB Autophagy protein 5 OS=Pongo abelii GN=ATG5 PE=2 SV=1 1 262 8.0E-15
sp|Q6BVI8|ATG5_DEBHA Autophagy protein 5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG5 PE=3 SV=2 4 265 3.0E-14
sp|Q9FFI2|ATG5_ARATH Autophagy protein 5 OS=Arabidopsis thaliana GN=ATG5 PE=2 SV=1 1 149 5.0E-13
sp|Q59VY1|ATG5_CANAL Autophagy protein 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG5 PE=3 SV=1 4 176 2.0E-12
sp|A3LR68|ATG5_PICST Autophagy protein 5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG5 PE=3 SV=2 1 176 3.0E-12
sp|A5DCZ3|ATG5_PICGU Autophagy protein 5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG5 PE=3 SV=2 1 262 3.0E-11
sp|A7TS83|ATG5_VANPO Autophagy protein 5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG5 PE=3 SV=1 97 268 4.0E-11
sp|P0CM36|ATG5_CRYNJ Autophagy protein 5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG5 PE=3 SV=1 101 266 3.0E-10
sp|P0CM37|ATG5_CRYNB Autophagy protein 5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG5 PE=3 SV=1 101 266 3.0E-10
sp|Q9W3R7|ATG5_DROME Autophagy protein 5 OS=Drosophila melanogaster GN=Atg5 PE=2 SV=2 4 261 5.0E-10
sp|Q6ZGL4|ATG5_ORYSJ Autophagy protein 5 OS=Oryza sativa subsp. japonica GN=ATG5 PE=2 SV=1 37 153 5.0E-08
sp|A2X052|ATG5_ORYSI Autophagy protein 5 OS=Oryza sativa subsp. indica GN=ATG5 PE=3 SV=2 37 153 5.0E-08
sp|Q54GT9|ATG5_DICDI Autophagy protein 5 OS=Dictyostelium discoideum GN=atg5 PE=3 SV=1 101 184 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0006914 autophagy Yes
GO:0009056 catabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0061919 process utilizing autophagic mechanism No
GO:0044237 cellular metabolic process No
GO:0005575 cellular_component No
GO:0044248 cellular catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4794
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3307
Ophiocordyceps australis map64 (Brazil) OphauB2|5013 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02199
Ophiocordyceps kimflemingae Ophio5|2882
Ophiocordyceps subramaniannii Hirsu2|10273

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5013
MTDSIAQTLWQARIPVVIRHASLSSPSAVPLVTSVPRFSYLAQLQPRLSLFFAGAACTSFYFEEVQLRNLPVGLL
VDLYRPRLPWQLVVGDGVAWDIGDTFLNSVKEADFVRNGNANQIMKMSKEHTTQLWESVVDNDYAAFSKINSRLL
NAPTALKNVPLRVYIPWGPTIASQAPPLSSLPVESASFKVIQALVTPAAPHGKPKLLGQTLRDLMPKLFPSSKDA
VLASAVMHGAPVPLTAPIEELMKEAAYPDGWLSLVVVVAAGVEG*
Coding >OphauB2|5013
ATGACAGACTCGATTGCGCAGACGCTTTGGCAGGCCCGGATCCCCGTCGTCATTCGACATGCGTCGCTGTCGAGC
CCGTCTGCCGTGCCGCTGGTGACGAGCGTGCCGCGTTTCAGCTACCTGGCCCAGCTGCAGCCGCGGCTGAGTCTG
TTTTTTGCAGGCGCGGCGTGCACGAGCTTTTACTTTGAAGAGGTGCAGCTGCGCAATCTGCCTGTTGGGCTGCTG
GTTGATTTATATCGCCCGCGTCTGCCGTGGCAGCTGGTGGTGGGCGATGGGGTGGCGTGGGATATTGGAGACACG
TTTTTGAATAGTGTCAAGGAGGCCGACTTTGTACGCAATGGAAACGCAAATCAAATCATGAAAATGTCCAAGGAA
CATACGACGCAGCTGTGGGAATCAGTCGTTGACAATGACTACGCCGCCTTTTCCAAGATTAACTCGCGTCTTCTC
AATGCCCCGACTGCCCTCAAAAACGTTCCGCTTCGAGTCTACATTCCTTGGGGTCCAACAATTGCCTCCCAAGCA
CCCCCGTTGTCGAGTCTGCCCGTCGAGTCGGCCTCGTTCAAGGTGATTCAGGCGCTCGTCACCCCTGCGGCCCCT
CATGGCAAGCCCAAGCTCCTGGGCCAGACGCTCAGAGACCTCATGCCCAAGCTATTCCCAAGCAGCAAAGACGCT
GTCCTGGCAAGTGCCGTCATGCATGGAGCGCCTGTACCGCTTACGGCGCCTATAGAGGAGCTGATGAAGGAGGCT
GCCTATCCAGATGGATGGCTCAGTCTTGTTGTTGTAGTGGCTGCCGGGGTCGAGGGGTAG
Transcript >OphauB2|5013
ATGACAGACTCGATTGCGCAGACGCTTTGGCAGGCCCGGATCCCCGTCGTCATTCGACATGCGTCGCTGTCGAGC
CCGTCTGCCGTGCCGCTGGTGACGAGCGTGCCGCGTTTCAGCTACCTGGCCCAGCTGCAGCCGCGGCTGAGTCTG
TTTTTTGCAGGCGCGGCGTGCACGAGCTTTTACTTTGAAGAGGTGCAGCTGCGCAATCTGCCTGTTGGGCTGCTG
GTTGATTTATATCGCCCGCGTCTGCCGTGGCAGCTGGTGGTGGGCGATGGGGTGGCGTGGGATATTGGAGACACG
TTTTTGAATAGTGTCAAGGAGGCCGACTTTGTACGCAATGGAAACGCAAATCAAATCATGAAAATGTCCAAGGAA
CATACGACGCAGCTGTGGGAATCAGTCGTTGACAATGACTACGCCGCCTTTTCCAAGATTAACTCGCGTCTTCTC
AATGCCCCGACTGCCCTCAAAAACGTTCCGCTTCGAGTCTACATTCCTTGGGGTCCAACAATTGCCTCCCAAGCA
CCCCCGTTGTCGAGTCTGCCCGTCGAGTCGGCCTCGTTCAAGGTGATTCAGGCGCTCGTCACCCCTGCGGCCCCT
CATGGCAAGCCCAAGCTCCTGGGCCAGACGCTCAGAGACCTCATGCCCAAGCTATTCCCAAGCAGCAAAGACGCT
GTCCTGGCAAGTGCCGTCATGCATGGAGCGCCTGTACCGCTTACGGCGCCTATAGAGGAGCTGATGAAGGAGGCT
GCCTATCCAGATGGATGGCTCAGTCTTGTTGTTGTAGTGGCTGCCGGGGTCGAGGGGTAG
Gene >OphauB2|5013
ATGACAGACTCGATTGCGCAGACGCTTTGGCAGGCCCGGATCCCCGTCGTCATTCGACATGCGTCGCTGTCGAGC
CCGTCTGCCGTGCCGCTGGTGACGAGCGTGCCGCGTTTCAGCTACCTGGCCCAGCTGCAGCCGCGGCTGAGTCTG
TTTTTTGCAGGCGCGGCGTGCACGAGCTTTTACTTTGAAGAGGTGCAGCTGCGCAATCTGCCTGTTGGGCTGCTG
GTTGATTTATATCGCCCGCGTCTGCCGTGGCAGCTGGTGGTGGGCGATGGGGTGGCGTGGGATATTGGAGACACG
TTTTTGAATAGTGTCAAGGAGGTGACTTTTTCTTCTTCTTCTTCTTCCTTCCCTCTACTGTTTTGTGGCTTTTTC
TTTTGTGGTTTGTTTTATGCGTGGCCCACGAGTCGCCAACGTTTTGTTCCTTGGAGAGGAGGGGGGGAGAGAGTC
GTTGAATTGCAAAAAGGTGTGATGCAAGGCGTCTGAGCTAACATTTGTTTCTTTGCTGCATGGCTTGCTAGGCCG
ACTTTGTACGCAATGGAAACGCAAATCAAATCATGAAAATGTCCAAGGAACATACGACGCAGCTGTGGGAATCAG
TCGTTGACAATGACTACGCCGCCTTTTCCAAGATTAACTCGCGTCTTCTCAATGCCCCGACTGCCCTCAAAAACG
TTCCGCTTCGAGTCTACATTCCTTGGGGTCCAACAATTGCCTCCCAAGCACCCCCGTTGTCGAGTCTGCCCGTCG
AGTCGGCCTCGTTCAAGGTGATTCAGGCGCTCGTCACCCCTGCGGCCCCTCATGGCAAGCCCAAGCTCCTGGGCC
AGACGCTCAGAGACCTCATGCCCAAGCTATTCCCAAGCAGCAAAGACGCTGTCCTGGCAAGTGCCGTCATGCATG
GAGCGCCTGTACCGCTTACGGCGCCTATAGAGGAGCTGATGAAGGAGGCTGCCTATCCAGATGGATGGCTCAGTC
TTGTTGTTGTAGTGGCTGCCGGGGTCGAGGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail