Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5006
Gene name
LocationContig_36:101105..103864
Strand+
Gene length (bp)2759
Transcript length (bp)2679
Coding sequence length (bp)2679
Protein length (aa) 893

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 2.0E-15 31 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94701|INN1_SCHPO Ingression protein fic1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fic1 PE=1 SV=1 28 154 7.0E-19
sp|Q62770|UN13C_RAT Protein unc-13 homolog C OS=Rattus norvegicus GN=Unc13c PE=1 SV=3 33 179 3.0E-07
sp|Q8K0T7|UN13C_MOUSE Protein unc-13 homolog C OS=Mus musculus GN=Unc13c PE=1 SV=3 33 179 3.0E-07
sp|Q8NB66|UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens GN=UNC13C PE=2 SV=3 33 147 1.0E-06
sp|Q9Z1N9|UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus GN=Unc13b PE=1 SV=2 33 148 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94701|INN1_SCHPO Ingression protein fic1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fic1 PE=1 SV=1 28 154 7.0E-19
sp|Q62770|UN13C_RAT Protein unc-13 homolog C OS=Rattus norvegicus GN=Unc13c PE=1 SV=3 33 179 3.0E-07
sp|Q8K0T7|UN13C_MOUSE Protein unc-13 homolog C OS=Mus musculus GN=Unc13c PE=1 SV=3 33 179 3.0E-07
sp|Q8NB66|UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens GN=UNC13C PE=2 SV=3 33 147 1.0E-06
sp|Q9Z1N9|UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus GN=Unc13b PE=1 SV=2 33 148 2.0E-06
sp|Q62769|UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus GN=Unc13b PE=1 SV=2 33 147 2.0E-06
sp|Q62768|UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus GN=Unc13a PE=1 SV=1 33 148 4.0E-06
sp|Q0JBH9|ERG3_ORYSJ Elicitor-responsive protein 3 OS=Oryza sativa subsp. japonica GN=ERG3 PE=2 SV=1 30 162 6.0E-06
sp|Q25AG5|ERG3_ORYSI Elicitor-responsive protein 3 OS=Oryza sativa subsp. indica GN=ERG3 PE=2 SV=1 30 162 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5006
MTTKTKTFALNGSHTAGIFADMSVDGPPIGTLVTIVDRAKNLPNRKTIGKQDPYCAARLGKEAKKTATDIRGGQT
PKWDQELRFTVHDCPDYYQLKISVFTDDKKTDLIGEAWIDLKAIIVAGGGQNDMWQTLTCKGKYAGEIRLEITFY
DTRPKPDKPPALHAHSTLSLSDKENGSVKQKTPMRRRPLPSDPITGGALSSSPSAPLSSSHSAPDLLLQTPPRSH
PVVPIHSPLQAVEYNTPCPHSSRQHGDHHSPPQPGQSTARVDGPRPERSRESKDATPRHFEEDGYSQKTPVSSCE
YADASRNHSQPPDSHVEMPVSEDPRQSVSMDDMRPPPPPVHRSRQESPLHKTPQSSSPMRHDVLKQEAHRHSSPS
YPGRPMFRAYDSAPSAPIHSSPPGHQVHEQAHPRYHSYDVSGSPHHHRSMQATVEDAPESPPTHLGSSPRQGGTR
MKSYDVMVAEENVHPKSIDADMPLRQSPKHMDQPPRYRRISQREHYDHLAARSQSFPLEANRAGYQSYVPPRERL
ELQYELVPSSQHYLPNHIMPEVPASLSPGMDPALSREIFEHIYDEELYERQHGASSMTIAKRGRRMIEAPPSTGA
YTLSNSPLQSHGGQRSSEVTYSGAPNDEMLRQASPIPSPSPQHAIRRKSLSPSPSPPQNRKSLDIPFGPDSYDAL
NPTLGSSRDPSPVNKERVLHDGKIITHDGKEIDPSDHLPMESWAPEPEARPSQTQSSAETRARPSPGGAQPMAAR
GRRPLRVARPLSTMTPQTYDFGDISQALEAPATTNRNRLQKRGNRSSMGGYATMSSPLAPVSADKLQDRQVMHVP
ARASLMGSHWDYANENHVSHAGYGPAIPAKVPLPLMSGANGMVDYGLMEEMQRIDIGAGRSRRRGGY*
Coding >OphauB2|5006
ATGACGACAAAGACAAAGACGTTTGCCCTCAATGGCAGCCACACGGCAGGCATTTTTGCCGACATGTCTGTCGAT
GGGCCTCCGATCGGCACCTTGGTCACTATTGTCGACAGGGCAAAGAACCTTCCAAATAGGAAGACCATCGGCAAG
CAAGATCCTTACTGTGCTGCTCGCCTCGGCAAGGAAGCCAAGAAGACGGCAACAGACATTCGAGGCGGCCAGACG
CCCAAGTGGGACCAAGAATTGCGCTTCACTGTCCACGATTGTCCCGACTACTACCAGCTCAAAATCTCCGTCTTC
ACCGATGACAAGAAGACGGACTTGATTGGCGAGGCATGGATCGATCTCAAGGCCATTATCGTTGCTGGAGGCGGC
CAGAACGACATGTGGCAGACACTGACGTGTAAAGGCAAATACGCTGGTGAGATACGGCTTGAGATTACTTTTTAT
GACACTCGACCGAAACCGGACAAGCCGCCTGCACTTCATGCCCATTCTACACTGTCACTGTCTGATAAAGAAAAC
GGCTCTGTAAAGCAAAAGACGCCCATGCGAAGAAGGCCTCTGCCGTCGGACCCAATTACTGGCGGCGCCTTGTCA
TCATCGCCGTCGGCACCACTTTCGTCGTCCCATTCGGCGCCCGACCTTCTTCTTCAGACTCCCCCCCGATCACAT
CCTGTCGTGCCCATACATTCGCCGCTTCAAGCTGTCGAGTATAATACACCATGCCCACATTCGTCTCGACAGCAT
GGCGACCACCACTCGCCGCCCCAGCCTGGCCAATCGACGGCGCGCGTTGACGGGCCTCGCCCAGAACGGTCACGC
GAGTCTAAAGACGCTACGCCCCGTCATTTTGAAGAAGACGGCTATAGTCAAAAGACTCCCGTGTCTTCTTGTGAG
TACGCGGATGCATCGAGAAACCACTCTCAGCCACCAGATAGCCACGTCGAAATGCCTGTGAGCGAGGACCCTAGA
CAATCCGTGTCAATGGATGACATGCGCCCACCGCCACCTCCTGTTCATCGATCACGACAAGAAAGCCCTCTACAC
AAGACACCGCAGTCTTCCTCGCCAATGAGACACGACGTACTCAAACAAGAGGCCCATAGGCATTCAAGTCCCTCG
TATCCGGGCCGCCCCATGTTTCGAGCCTATGACTCGGCACCATCGGCACCAATTCACTCTTCACCTCCTGGCCAC
CAAGTACACGAACAGGCACATCCCAGGTATCACTCGTACGATGTATCCGGCAGTCCGCACCACCACCGCTCAATG
CAAGCCACAGTTGAGGATGCTCCAGAGTCGCCGCCTACGCACTTGGGCAGCTCACCTAGGCAAGGAGGCACTAGA
ATGAAGTCGTATGACGTCATGGTGGCCGAGGAAAATGTGCATCCGAAATCTATTGACGCTGACATGCCTCTGCGC
CAATCACCCAAGCATATGGACCAACCACCAAGATATCGTCGTATATCTCAGCGAGAACACTACGATCATCTTGCT
GCAAGGTCTCAGTCTTTTCCCTTGGAAGCGAACCGTGCCGGTTATCAGTCTTACGTACCTCCGAGAGAAAGGCTC
GAGTTGCAGTATGAGTTGGTGCCCAGCAGCCAACATTATCTACCCAACCACATCATGCCTGAAGTCCCTGCTTCT
CTATCACCCGGCATGGATCCAGCTCTCTCACGGGAGATTTTTGAGCACATTTACGATGAAGAGTTGTACGAGAGG
CAGCACGGTGCTTCATCCATGACGATTGCAAAAAGAGGTCGACGCATGATTGAAGCTCCCCCTTCAACGGGGGCT
TATACGTTGAGCAACTCACCACTCCAGTCGCACGGGGGCCAGCGCTCGAGCGAGGTGACATACTCGGGGGCACCA
AACGATGAGATGTTGCGGCAGGCATCTCCGATTCCAAGTCCCAGCCCGCAGCATGCGATTCGCCGCAAGTCGCTA
AGTCCATCACCGTCGCCGCCACAGAATAGGAAGTCTTTGGACATACCATTTGGCCCAGATTCATATGACGCCTTG
AACCCTACTCTTGGGTCTTCTCGGGACCCTAGTCCGGTCAACAAGGAACGAGTGCTGCACGATGGTAAGATTATT
ACACACGACGGTAAAGAGATTGACCCGTCAGACCACCTGCCCATGGAGAGTTGGGCCCCAGAACCTGAAGCCCGA
CCAAGTCAGACACAGAGTTCAGCCGAGACACGAGCCCGGCCGTCGCCAGGGGGAGCTCAGCCCATGGCTGCTCGC
GGCCGTCGCCCGCTGCGCGTTGCTCGGCCGCTGTCTACAATGACACCACAGACGTACGACTTTGGCGACATATCG
CAGGCTCTTGAAGCGCCGGCCACGACTAATCGCAATCGCCTGCAAAAGAGGGGCAACCGAAGCAGCATGGGTGGC
TATGCTACAATGTCTAGTCCGCTTGCGCCTGTATCAGCGGACAAGTTGCAGGACAGACAGGTGATGCATGTGCCA
GCGCGTGCGTCTCTTATGGGGAGTCACTGGGACTATGCCAATGAGAACCACGTGTCGCATGCAGGATACGGGCCA
GCAATTCCAGCCAAGGTTCCGCTGCCACTGATGAGTGGCGCCAACGGCATGGTGGACTATGGCCTGATGGAGGAG
ATGCAGAGAATTGATATTGGCGCTGGCAGGTCTAGACGGAGGGGAGGATATTGA
Transcript >OphauB2|5006
ATGACGACAAAGACAAAGACGTTTGCCCTCAATGGCAGCCACACGGCAGGCATTTTTGCCGACATGTCTGTCGAT
GGGCCTCCGATCGGCACCTTGGTCACTATTGTCGACAGGGCAAAGAACCTTCCAAATAGGAAGACCATCGGCAAG
CAAGATCCTTACTGTGCTGCTCGCCTCGGCAAGGAAGCCAAGAAGACGGCAACAGACATTCGAGGCGGCCAGACG
CCCAAGTGGGACCAAGAATTGCGCTTCACTGTCCACGATTGTCCCGACTACTACCAGCTCAAAATCTCCGTCTTC
ACCGATGACAAGAAGACGGACTTGATTGGCGAGGCATGGATCGATCTCAAGGCCATTATCGTTGCTGGAGGCGGC
CAGAACGACATGTGGCAGACACTGACGTGTAAAGGCAAATACGCTGGTGAGATACGGCTTGAGATTACTTTTTAT
GACACTCGACCGAAACCGGACAAGCCGCCTGCACTTCATGCCCATTCTACACTGTCACTGTCTGATAAAGAAAAC
GGCTCTGTAAAGCAAAAGACGCCCATGCGAAGAAGGCCTCTGCCGTCGGACCCAATTACTGGCGGCGCCTTGTCA
TCATCGCCGTCGGCACCACTTTCGTCGTCCCATTCGGCGCCCGACCTTCTTCTTCAGACTCCCCCCCGATCACAT
CCTGTCGTGCCCATACATTCGCCGCTTCAAGCTGTCGAGTATAATACACCATGCCCACATTCGTCTCGACAGCAT
GGCGACCACCACTCGCCGCCCCAGCCTGGCCAATCGACGGCGCGCGTTGACGGGCCTCGCCCAGAACGGTCACGC
GAGTCTAAAGACGCTACGCCCCGTCATTTTGAAGAAGACGGCTATAGTCAAAAGACTCCCGTGTCTTCTTGTGAG
TACGCGGATGCATCGAGAAACCACTCTCAGCCACCAGATAGCCACGTCGAAATGCCTGTGAGCGAGGACCCTAGA
CAATCCGTGTCAATGGATGACATGCGCCCACCGCCACCTCCTGTTCATCGATCACGACAAGAAAGCCCTCTACAC
AAGACACCGCAGTCTTCCTCGCCAATGAGACACGACGTACTCAAACAAGAGGCCCATAGGCATTCAAGTCCCTCG
TATCCGGGCCGCCCCATGTTTCGAGCCTATGACTCGGCACCATCGGCACCAATTCACTCTTCACCTCCTGGCCAC
CAAGTACACGAACAGGCACATCCCAGGTATCACTCGTACGATGTATCCGGCAGTCCGCACCACCACCGCTCAATG
CAAGCCACAGTTGAGGATGCTCCAGAGTCGCCGCCTACGCACTTGGGCAGCTCACCTAGGCAAGGAGGCACTAGA
ATGAAGTCGTATGACGTCATGGTGGCCGAGGAAAATGTGCATCCGAAATCTATTGACGCTGACATGCCTCTGCGC
CAATCACCCAAGCATATGGACCAACCACCAAGATATCGTCGTATATCTCAGCGAGAACACTACGATCATCTTGCT
GCAAGGTCTCAGTCTTTTCCCTTGGAAGCGAACCGTGCCGGTTATCAGTCTTACGTACCTCCGAGAGAAAGGCTC
GAGTTGCAGTATGAGTTGGTGCCCAGCAGCCAACATTATCTACCCAACCACATCATGCCTGAAGTCCCTGCTTCT
CTATCACCCGGCATGGATCCAGCTCTCTCACGGGAGATTTTTGAGCACATTTACGATGAAGAGTTGTACGAGAGG
CAGCACGGTGCTTCATCCATGACGATTGCAAAAAGAGGTCGACGCATGATTGAAGCTCCCCCTTCAACGGGGGCT
TATACGTTGAGCAACTCACCACTCCAGTCGCACGGGGGCCAGCGCTCGAGCGAGGTGACATACTCGGGGGCACCA
AACGATGAGATGTTGCGGCAGGCATCTCCGATTCCAAGTCCCAGCCCGCAGCATGCGATTCGCCGCAAGTCGCTA
AGTCCATCACCGTCGCCGCCACAGAATAGGAAGTCTTTGGACATACCATTTGGCCCAGATTCATATGACGCCTTG
AACCCTACTCTTGGGTCTTCTCGGGACCCTAGTCCGGTCAACAAGGAACGAGTGCTGCACGATGGTAAGATTATT
ACACACGACGGTAAAGAGATTGACCCGTCAGACCACCTGCCCATGGAGAGTTGGGCCCCAGAACCTGAAGCCCGA
CCAAGTCAGACACAGAGTTCAGCCGAGACACGAGCCCGGCCGTCGCCAGGGGGAGCTCAGCCCATGGCTGCTCGC
GGCCGTCGCCCGCTGCGCGTTGCTCGGCCGCTGTCTACAATGACACCACAGACGTACGACTTTGGCGACATATCG
CAGGCTCTTGAAGCGCCGGCCACGACTAATCGCAATCGCCTGCAAAAGAGGGGCAACCGAAGCAGCATGGGTGGC
TATGCTACAATGTCTAGTCCGCTTGCGCCTGTATCAGCGGACAAGTTGCAGGACAGACAGGTGATGCATGTGCCA
GCGCGTGCGTCTCTTATGGGGAGTCACTGGGACTATGCCAATGAGAACCACGTGTCGCATGCAGGATACGGGCCA
GCAATTCCAGCCAAGGTTCCGCTGCCACTGATGAGTGGCGCCAACGGCATGGTGGACTATGGCCTGATGGAGGAG
ATGCAGAGAATTGATATTGGCGCTGGCAGGTCTAGACGGAGGGGAGGATATTGA
Gene >OphauB2|5006
ATGACGACAAAGACAAAGACGTTTGCCCTCAATGGCAGCCACACGGCAGGCATTTTTGCCGACATGTCTGTCGAT
GGGCCTCCGATCGGCACCTTGGTCACTATTGTCGACAGGGCAAAGAACCTTCCAAATAGGAAGACCATCGGCAAG
CAAGATCCTTACTGTGCTGCTCGCCTCGGCAAGGAAGCCAAGAAGACGGCAACAGACATTCGAGGCGGCCAGACG
CCCAAGTGGTAGGCATCTATTTACCTCATGATTCTCCCCCCCGAAAAAAGTAGCCTACTGACCGGCGGGTTGACT
ACCTGCCCCAAAGGGACCAAGAATTGCGCTTCACTGTCCACGATTGTCCCGACTACTACCAGCTCAAAATCTCCG
TCTTCACCGATGACAAGAAGACGGACTTGATTGGCGAGGCATGGATCGATCTCAAGGCCATTATCGTTGCTGGAG
GCGGCCAGAACGACATGTGGCAGACACTGACGTGTAAAGGCAAATACGCTGGTGAGATACGGCTTGAGATTACTT
TTTATGACACTCGACCGAAACCGGACAAGCCGCCTGCACTTCATGCCCATTCTACACTGTCACTGTCTGATAAAG
AAAACGGCTCTGTAAAGCAAAAGACGCCCATGCGAAGAAGGCCTCTGCCGTCGGACCCAATTACTGGCGGCGCCT
TGTCATCATCGCCGTCGGCACCACTTTCGTCGTCCCATTCGGCGCCCGACCTTCTTCTTCAGACTCCCCCCCGAT
CACATCCTGTCGTGCCCATACATTCGCCGCTTCAAGCTGTCGAGTATAATACACCATGCCCACATTCGTCTCGAC
AGCATGGCGACCACCACTCGCCGCCCCAGCCTGGCCAATCGACGGCGCGCGTTGACGGGCCTCGCCCAGAACGGT
CACGCGAGTCTAAAGACGCTACGCCCCGTCATTTTGAAGAAGACGGCTATAGTCAAAAGACTCCCGTGTCTTCTT
GTGAGTACGCGGATGCATCGAGAAACCACTCTCAGCCACCAGATAGCCACGTCGAAATGCCTGTGAGCGAGGACC
CTAGACAATCCGTGTCAATGGATGACATGCGCCCACCGCCACCTCCTGTTCATCGATCACGACAAGAAAGCCCTC
TACACAAGACACCGCAGTCTTCCTCGCCAATGAGACACGACGTACTCAAACAAGAGGCCCATAGGCATTCAAGTC
CCTCGTATCCGGGCCGCCCCATGTTTCGAGCCTATGACTCGGCACCATCGGCACCAATTCACTCTTCACCTCCTG
GCCACCAAGTACACGAACAGGCACATCCCAGGTATCACTCGTACGATGTATCCGGCAGTCCGCACCACCACCGCT
CAATGCAAGCCACAGTTGAGGATGCTCCAGAGTCGCCGCCTACGCACTTGGGCAGCTCACCTAGGCAAGGAGGCA
CTAGAATGAAGTCGTATGACGTCATGGTGGCCGAGGAAAATGTGCATCCGAAATCTATTGACGCTGACATGCCTC
TGCGCCAATCACCCAAGCATATGGACCAACCACCAAGATATCGTCGTATATCTCAGCGAGAACACTACGATCATC
TTGCTGCAAGGTCTCAGTCTTTTCCCTTGGAAGCGAACCGTGCCGGTTATCAGTCTTACGTACCTCCGAGAGAAA
GGCTCGAGTTGCAGTATGAGTTGGTGCCCAGCAGCCAACATTATCTACCCAACCACATCATGCCTGAAGTCCCTG
CTTCTCTATCACCCGGCATGGATCCAGCTCTCTCACGGGAGATTTTTGAGCACATTTACGATGAAGAGTTGTACG
AGAGGCAGCACGGTGCTTCATCCATGACGATTGCAAAAAGAGGTCGACGCATGATTGAAGCTCCCCCTTCAACGG
GGGCTTATACGTTGAGCAACTCACCACTCCAGTCGCACGGGGGCCAGCGCTCGAGCGAGGTGACATACTCGGGGG
CACCAAACGATGAGATGTTGCGGCAGGCATCTCCGATTCCAAGTCCCAGCCCGCAGCATGCGATTCGCCGCAAGT
CGCTAAGTCCATCACCGTCGCCGCCACAGAATAGGAAGTCTTTGGACATACCATTTGGCCCAGATTCATATGACG
CCTTGAACCCTACTCTTGGGTCTTCTCGGGACCCTAGTCCGGTCAACAAGGAACGAGTGCTGCACGATGGTAAGA
TTATTACACACGACGGTAAAGAGATTGACCCGTCAGACCACCTGCCCATGGAGAGTTGGGCCCCAGAACCTGAAG
CCCGACCAAGTCAGACACAGAGTTCAGCCGAGACACGAGCCCGGCCGTCGCCAGGGGGAGCTCAGCCCATGGCTG
CTCGCGGCCGTCGCCCGCTGCGCGTTGCTCGGCCGCTGTCTACAATGACACCACAGACGTACGACTTTGGCGACA
TATCGCAGGCTCTTGAAGCGCCGGCCACGACTAATCGCAATCGCCTGCAAAAGAGGGGCAACCGAAGCAGCATGG
GTGGCTATGCTACAATGTCTAGTCCGCTTGCGCCTGTATCAGCGGACAAGTTGCAGGACAGACAGGTGATGCATG
TGCCAGCGCGTGCGTCTCTTATGGGGAGTCACTGGGACTATGCCAATGAGAACCACGTGTCGCATGCAGGATACG
GGCCAGCAATTCCAGCCAAGGTTCCGCTGCCACTGATGAGTGGCGCCAACGGCATGGTGGACTATGGCCTGATGG
AGGAGATGCAGAGAATTGATATTGGCGCTGGCAGGTCTAGACGGAGGGGAGGATATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail