Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5
Gene name
LocationContig_1:11401..13030
Strand+
Gene length (bp)1629
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03798 TRAM_LAG1_CLN8 TLC domain 1.0E-44 158 387
PF08390 TRAM1 TRAM1-like protein 4.9E-22 96 154

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78970|LAG1_SCHPO Sphingosine N-acyltransferase lag1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lag1 PE=1 SV=2 71 411 4.0E-68
sp|P28496|LAC1_YEAST Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAC1 PE=1 SV=2 11 322 1.0E-37
sp|A6ZZV7|LAC1_YEAS7 Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAC1 PE=3 SV=1 11 322 1.0E-37
sp|A6ZSP9|LAG1_YEAS7 Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAG1 PE=3 SV=1 1 414 9.0E-34
sp|P38703|LAG1_YEAST Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAG1 PE=1 SV=1 1 414 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78970|LAG1_SCHPO Sphingosine N-acyltransferase lag1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lag1 PE=1 SV=2 71 411 4.0E-68
sp|P28496|LAC1_YEAST Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAC1 PE=1 SV=2 11 322 1.0E-37
sp|A6ZZV7|LAC1_YEAS7 Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAC1 PE=3 SV=1 11 322 1.0E-37
sp|A6ZSP9|LAG1_YEAS7 Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAG1 PE=3 SV=1 1 414 9.0E-34
sp|P38703|LAG1_YEAST Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAG1 PE=1 SV=1 1 414 1.0E-33
sp|O59735|LAC1_SCHPO Sphingosine N-acyltransferase lac1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lac1 PE=1 SV=2 2 314 3.0E-27
sp|G5ED45|HYL1_CAEEL Ceramide synthase hyl-1 OS=Caenorhabditis elegans GN=hyl-1 PE=1 SV=1 153 413 7.0E-21
sp|Q6NQI8|LAG13_ARATH LAG1 longevity assurance homolog 3 OS=Arabidopsis thaliana GN=At1g13580 PE=2 SV=2 152 413 8.0E-21
sp|Q84QC0|ASCL3_ORYSJ ASC1-like protein 3 OS=Oryza sativa subsp. japonica GN=Os03g0264000 PE=2 SV=1 156 408 5.0E-20
sp|Q9LDF2|LAG11_ARATH LAG1 longevity assurance homolog 1 OS=Arabidopsis thaliana GN=LAG1 PE=2 SV=1 116 413 2.0E-19
sp|Q9LJK3|LAG12_ARATH LAG1 longevity assurance homolog 2 OS=Arabidopsis thaliana GN=LAG2 PE=1 SV=1 146 408 6.0E-19
sp|Q6EUN0|ASCL1_ORYSJ ASC1-like protein 1 OS=Oryza sativa subsp. japonica GN=Os02g0581300 PE=2 SV=1 153 413 2.0E-18
sp|Q8W4Y5|ASCL_SOLLC ASC1-like protein OS=Solanum lycopersicum PE=2 SV=1 152 411 1.0E-17
sp|Q9D6J1|CERS4_MOUSE Ceramide synthase 4 OS=Mus musculus GN=Cers4 PE=1 SV=1 144 418 2.0E-16
sp|Q8N5B7|CERS5_HUMAN Ceramide synthase 5 OS=Homo sapiens GN=CERS5 PE=2 SV=1 144 306 4.0E-16
sp|Q96G23|CERS2_HUMAN Ceramide synthase 2 OS=Homo sapiens GN=CERS2 PE=1 SV=1 144 404 4.0E-16
sp|Q7Z139|HYL2_CAEEL Ceramide synthase hyl-2 OS=Caenorhabditis elegans GN=hyl-2 PE=1 SV=1 143 306 8.0E-16
sp|Q924Z4|CERS2_MOUSE Ceramide synthase 2 OS=Mus musculus GN=Cers2 PE=1 SV=1 144 404 2.0E-15
sp|Q6ZMG9|CERS6_HUMAN Ceramide synthase 6 OS=Homo sapiens GN=CERS6 PE=1 SV=1 144 302 9.0E-15
sp|Q3ZBF8|CERS2_BOVIN Ceramide synthase 2 OS=Bos taurus GN=CERS2 PE=2 SV=1 144 404 1.0E-14
sp|Q6YWS8|ASCL2_ORYSJ ASC1-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0728300 PE=3 SV=2 153 403 2.0E-14
sp|Q8C172|CERS6_MOUSE Ceramide synthase 6 OS=Mus musculus GN=Cers6 PE=1 SV=1 144 302 3.0E-14
sp|Q9D6K9|CERS5_MOUSE Ceramide synthase 5 OS=Mus musculus GN=Cers5 PE=1 SV=1 144 402 4.0E-14
sp|Q9M6A3|ASC1_SOLLC Protein ASC1 OS=Solanum lycopersicum GN=Asc-1 PE=2 SV=2 147 413 3.0E-13
sp|Q5E9R6|CERS4_BOVIN Ceramide synthase 4 OS=Bos taurus GN=CERS4 PE=2 SV=1 144 420 8.0E-13
sp|Q9HA82|CERS4_HUMAN Ceramide synthase 4 OS=Homo sapiens GN=CERS4 PE=1 SV=2 144 422 8.0E-13
sp|Q1A3B0|CERS3_MOUSE Ceramide synthase 3 OS=Mus musculus GN=Cers3 PE=1 SV=1 148 405 8.0E-11
sp|Q8IU89|CERS3_HUMAN Ceramide synthase 3 OS=Homo sapiens GN=CERS3 PE=1 SV=2 156 403 5.0E-10
sp|Q9XWE9|LAGR1_CAEEL Probable ceramide synthase lagr-1 OS=Caenorhabditis elegans GN=lagr-1 PE=3 SV=1 107 432 2.0E-08
sp|P27545|CERS1_MOUSE Ceramide synthase 1 OS=Mus musculus GN=Cers1 PE=1 SV=1 123 430 5.0E-08
sp|Q924Z5|TRAM2_MOUSE Translocating chain-associated membrane protein 2 OS=Mus musculus GN=Tram2 PE=1 SV=1 106 231 1.0E-07
sp|Q15035|TRAM2_HUMAN Translocating chain-associated membrane protein 2 OS=Homo sapiens GN=TRAM2 PE=1 SV=1 106 231 6.0E-07
sp|P27544|CERS1_HUMAN Ceramide synthase 1 OS=Homo sapiens GN=CERS1 PE=1 SV=1 130 270 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 72 89 17
2 120 142 22
3 163 180 17
4 208 225 17
5 257 274 17
6 289 311 22
7 363 385 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1356
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3884
Ophiocordyceps australis map64 (Brazil) OphauB2|5 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03841
Ophiocordyceps camponoti-rufipedis Ophun1|3691
Ophiocordyceps kimflemingae Ophio5|7661
Ophiocordyceps subramaniannii Hirsu2|10769

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5
MADSHAGNALPDASAAKAAARPQLKSGSSNPNMNGPLYMQTASSNIVLVRRLKRKDESTWKHLARWFVENQIGLS
FNLLALLFLAHFFIPKARSHTHKFFHLAYYDADSNKYGIGFDDAYFITFCVVLFTGMRAVAMEYILAPFARLQGV
SKRKILTRFSEQAWLFIYYAVFWTLGMYIYSKSPYYLNMKGLWTDWPKRELDGLVKGYILAQWAFWLQQIIVINI
EERRKDHWQMFSHHIITTALIWSCYCYHQTRVGNFILVIMDVVDLFFPVAKCLKYTGHNTLCDIAFGIFMVSWFV
ARHILYLLVCWSVYHDSVTEINIGCYTGVASTLEGPQEPPSSLSYMLEPFFNATGRVCYDDRVKWAFLLPLLLLQ
VITIAWFTMIVRVAIKVIRGDGAEDTRSDDEDEVEDEDEFVYEEALEEEVSVDALNLKTWERRTGIKRQASSSGV
SLPGHSDRKELLGRIGCEKQVE*
Coding >OphauB2|5
ATGGCCGACTCGCACGCTGGCAATGCGTTGCCTGACGCTTCGGCGGCAAAGGCTGCTGCGCGACCTCAACTCAAG
TCGGGCTCGAGCAATCCCAACATGAACGGCCCATTGTACATGCAGACGGCCAGCTCCAACATTGTCCTTGTGCGG
CGGCTCAAGCGCAAAGACGAGAGCACTTGGAAGCATCTAGCTCGCTGGTTCGTCGAGAACCAAATTGGCCTCTCC
TTCAACCTGCTTGCCCTCCTCTTCCTCGCCCACTTCTTCATCCCCAAGGCTAGATCGCACACGCACAAGTTCTTC
CACCTGGCCTACTACGACGCAGATAGCAACAAATATGGCATTGGCTTTGATGATGCCTATTTCATCACCTTTTGT
GTCGTGCTATTTACCGGTATGCGCGCAGTCGCCATGGAGTACATCTTGGCGCCATTTGCCAGGCTCCAGGGCGTC
TCCAAGCGCAAAATCCTTACCCGCTTCAGCGAGCAGGCCTGGCTCTTTATATACTATGCCGTCTTTTGGACGCTC
GGAATGTACATTTACAGCAAGTCACCCTATTACCTCAACATGAAGGGGCTCTGGACCGACTGGCCCAAGCGAGAG
CTCGACGGCCTGGTAAAGGGCTACATCCTGGCACAATGGGCATTCTGGCTCCAGCAAATCATTGTCATCAACATT
GAGGAGCGGCGCAAGGACCACTGGCAAATGTTTAGCCACCACATCATTACCACTGCACTCATCTGGTCGTGCTAC
TGCTACCACCAAACTCGGGTCGGAAACTTTATTCTGGTCATTATGGATGTCGTTGACCTCTTCTTTCCCGTTGCC
AAGTGCCTTAAGTACACTGGCCACAACACGCTCTGCGACATTGCCTTTGGCATCTTTATGGTTTCATGGTTTGTG
GCACGGCACATTCTTTACCTGTTGGTTTGTTGGTCTGTGTACCACGACTCGGTCACGGAAATTAATATTGGCTGC
TACACGGGCGTTGCCTCGACGCTTGAGGGGCCGCAAGAGCCTCCGTCGAGCTTGTCATACATGCTGGAGCCATTC
TTCAATGCGACTGGCCGCGTCTGCTATGATGATAGAGTCAAGTGGGCTTTTCTGCTTCCGCTCCTCTTGTTGCAG
GTGATTACCATTGCATGGTTCACCATGATTGTCCGCGTCGCCATCAAGGTGATTCGCGGCGACGGGGCGGAAGAC
ACTAGAAGTGACGACGAGGATGAAGTCGAGGACGAGGACGAGTTTGTCTATGAGGAGGCTCTCGAGGAGGAGGTG
AGCGTGGATGCGTTGAATCTCAAGACTTGGGAGCGGCGGACGGGCATCAAGCGCCAGGCTAGTAGCTCGGGGGTC
AGCTTGCCAGGACACAGTGACCGCAAGGAGTTGCTGGGACGCATTGGCTGCGAGAAGCAAGTGGAATAG
Transcript >OphauB2|5
ATGGCCGACTCGCACGCTGGCAATGCGTTGCCTGACGCTTCGGCGGCAAAGGCTGCTGCGCGACCTCAACTCAAG
TCGGGCTCGAGCAATCCCAACATGAACGGCCCATTGTACATGCAGACGGCCAGCTCCAACATTGTCCTTGTGCGG
CGGCTCAAGCGCAAAGACGAGAGCACTTGGAAGCATCTAGCTCGCTGGTTCGTCGAGAACCAAATTGGCCTCTCC
TTCAACCTGCTTGCCCTCCTCTTCCTCGCCCACTTCTTCATCCCCAAGGCTAGATCGCACACGCACAAGTTCTTC
CACCTGGCCTACTACGACGCAGATAGCAACAAATATGGCATTGGCTTTGATGATGCCTATTTCATCACCTTTTGT
GTCGTGCTATTTACCGGTATGCGCGCAGTCGCCATGGAGTACATCTTGGCGCCATTTGCCAGGCTCCAGGGCGTC
TCCAAGCGCAAAATCCTTACCCGCTTCAGCGAGCAGGCCTGGCTCTTTATATACTATGCCGTCTTTTGGACGCTC
GGAATGTACATTTACAGCAAGTCACCCTATTACCTCAACATGAAGGGGCTCTGGACCGACTGGCCCAAGCGAGAG
CTCGACGGCCTGGTAAAGGGCTACATCCTGGCACAATGGGCATTCTGGCTCCAGCAAATCATTGTCATCAACATT
GAGGAGCGGCGCAAGGACCACTGGCAAATGTTTAGCCACCACATCATTACCACTGCACTCATCTGGTCGTGCTAC
TGCTACCACCAAACTCGGGTCGGAAACTTTATTCTGGTCATTATGGATGTCGTTGACCTCTTCTTTCCCGTTGCC
AAGTGCCTTAAGTACACTGGCCACAACACGCTCTGCGACATTGCCTTTGGCATCTTTATGGTTTCATGGTTTGTG
GCACGGCACATTCTTTACCTGTTGGTTTGTTGGTCTGTGTACCACGACTCGGTCACGGAAATTAATATTGGCTGC
TACACGGGCGTTGCCTCGACGCTTGAGGGGCCGCAAGAGCCTCCGTCGAGCTTGTCATACATGCTGGAGCCATTC
TTCAATGCGACTGGCCGCGTCTGCTATGATGATAGAGTCAAGTGGGCTTTTCTGCTTCCGCTCCTCTTGTTGCAG
GTGATTACCATTGCATGGTTCACCATGATTGTCCGCGTCGCCATCAAGGTGATTCGCGGCGACGGGGCGGAAGAC
ACTAGAAGTGACGACGAGGATGAAGTCGAGGACGAGGACGAGTTTGTCTATGAGGAGGCTCTCGAGGAGGAGGTG
AGCGTGGATGCGTTGAATCTCAAGACTTGGGAGCGGCGGACGGGCATCAAGCGCCAGGCTAGTAGCTCGGGGGTC
AGCTTGCCAGGACACAGTGACCGCAAGGAGTTGCTGGGACGCATTGGCTGCGAGAAGCAAGTGGAATAG
Gene >OphauB2|5
ATGGCCGACTCGCACGCTGGCAATGCGTTGCCTGACGCTTCGGCGGCAAAGGCTGCTGCGCGACCTCAACTCAAG
TCGGGCTCGAGCAATCCCAACATGAACGGCCCATTGTACATGCAGACGGCCAGCTCCAACATTGTCCTTGTGCGG
CGGCTCAAGCGCAAAGACGAGAGCACTTGGAAGCATCTAGCTCGCTGGTTCGTCGAGAACCAAATTGGTCCGTCT
GCCCCTGCTTGTCAACTGCCGTGCAACTCTCTGCCTTTGTTTGCGTCACCTTGGCTTGGCGTCACTGACGGCAAA
GCTCTCTAGGCCTCTCCTTCAACCTGCTTGCCCTCCTCTTCCTCGCCCACTTCTTCATCCCCAAGGCTAGATCGC
ACACGCACAAGTTCTTCCACCTGGCCTACTACGACGCAGATAGCAACAAATATGGCATTGGCTTTGATGATGCCT
ATTTCATCACCTTTTGTGTCGTGCTATTTACCGGTATGCGCGCAGTCGCCATGGAGTACATCTTGGCGCCATTTG
CCAGGCTCCAGGGCGTCTCCAAGCGCAAAATCCTTACCCGCTTCAGCGAGCAGGCCTGGCTCTTTATATACTATG
CCGTCTTTTGGACGCTCGGAATGGTGAGAGCATGTTGCGCGTCCCACATGAGCCGCACCAAAAAAAAAATCGGTA
TTGACATGGTGGCAGTACATTTACAGCAAGTCACCCTATTACCTCAACATGAAGGGGCTCTGGACCGACTGGCCC
AAGCGAGAGCTCGACGGCCTGGTAAAGGGCTACATCCTGGCACAATGGGCATTCTGGCTCCAGCAAATCATTGTC
ATCAACATTGAGGAGCGGCGCAAGGACCACTGGCAAATGTTTAGCCACCACATCATTACCACTGCACTCATCTGG
TCGTGCTACTGCTACCACCAAACTCGGGTCGGAAACTTTATTCTGGTCATTATGGATGTCGTTGACCTCTTCTTT
CCCGTAAGAGTCTGCAACTAGCCTGTCTGTGCATGGGGTCTGACTGTTGAGCAGGTTGCCAAGTGCCTTAAGTAC
ACTGGCCACAACACGCTCTGCGACATTGCCTTTGGCATCTTTATGGTTTCATGGTTTGTGGCACGGCACATTCTT
TACCTGTTGGTTTGTTGGTCTGTGTACCACGACTCGGTCACGGAAATTAATATTGGCTGCTACACGGGCGTTGCC
TCGACGCTTGAGGGGCCGCAAGAGCCTCCGTCGAGCTTGTCATACATGCTGGAGCCATTCTTCAATGCGACTGGC
CGCGTCTGCTATGATGATAGAGTCAAGTGGGCTTTTCTGCTTCCGCTCCTCTTGTTGCAGGTGATTACCATTGCA
TGGTTCACCATGATTGTCCGCGTCGCCATCAAGGTGATTCGCGGCGACGGGGCGGAAGACACTAGAAGTGACGAC
GAGGATGAAGTCGAGGACGAGGACGAGTTTGTCTATGAGGAGGCTCTCGAGGAGGAGGTGAGCGTGGATGCGTTG
AATCTCAAGACTTGGGAGCGGCGGACGGGCATCAAGCGCCAGGCTAGTAGCTCGGGGGTCAGCTTGCCAGGACAC
AGTGACCGCAAGGAGTTGCTGGGACGCATTGGCTGCGAGAAGCAAGTGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail